Recombinant Arabidopsis thaliana CASP-like protein At4g15620 (At4g15620)

What is the functional role of CASP-like protein At4g15620 in Arabidopsis thaliana?

The At4g15620 gene encodes a CASP-like protein 1E2 (AtCASPL1E2) that belongs to the Casparian strip membrane domain protein (CASP) family. Based on its sequence characteristics and structural predictions, this protein is believed to play a role in the formation of transport barriers in plant tissues, similar to other CASP family members. The protein consists of 190 amino acids and contains transmembrane domains characteristic of membrane-localized proteins .

The specific function of At4g15620 is still being investigated, but transcriptomic studies suggest it may be involved in stress responses, particularly under drought and hypoxic conditions. The protein's structure indicates it may function in membrane organization or as part of transport complexes within cell membranes. Research methodologies to determine its function typically include gene knockout/knockdown studies, subcellular localization experiments, and protein-protein interaction analyses.

How is At4g15620 expression regulated under different stress conditions?

RNA sequencing studies have shown that At4g15620 expression can be modulated under various stress conditions. In particular:

• Under drought stress conditions, At4g15620 shows differential expression patterns as part of the broader transcriptomic response of Arabidopsis to water limitation .

• Hypoxia studies suggest potential regulation as part of stress-responsive gene networks, though it may not be among the most prominently regulated genes in meta-analyses of RNA-Seq data .

To properly investigate expression regulation, researchers should:

• Design time-course experiments that capture both early and late responses

• Include appropriate controls for each stress condition

• Use RT-qPCR to validate RNA-Seq findings with primers specific to At4g15620

• Consider tissue-specific expression patterns, as regulation may differ between roots and shoots

What are the structural characteristics of the recombinant His-tagged At4g15620 protein?

The recombinant full-length Arabidopsis thaliana CASP-like protein At4g15620 consists of 190 amino acids with the following structural characteristics:

• Complete amino acid sequence: MEHEGKNNMNGMEMEKGKRELGSRKGVELTMRVLALILTMAAATVLGVAKQTKVVSIKLI PTLPPLDITTTAKASYLSAFVYNISVNAIACGYTAISIAILMISRGRRSKKLLMVVLLGD LVMVALLFSGTGAASAIGLMGLHGNKHVMWKKVCGVFGKFCHRAAPSLPLTLLAAVVFMF LVVLDAIKLP

• N-terminal His-tag for purification and detection purposes

• Predicted transmembrane domains that suggest membrane localization

• Conserved domains characteristic of CASP family proteins

For structural studies, researchers should consider:

• Using circular dichroism (CD) spectroscopy to assess secondary structure composition

• Membrane protein crystallization techniques if attempting structural determination

• Molecular dynamics simulations to predict membrane integration patterns

What are optimal conditions for expression and purification of recombinant At4g15620?

Based on the available information about the recombinant protein, the following methodology is recommended:

Expression System:

• Host: E. coli (BL21 or similar expression strain)

• Vector: pET or similar with N-terminal His-tag

• Induction: 0.5-1.0 mM IPTG at OD600 0.6-0.8

• Temperature: Consider lower temperatures (16-18°C) for membrane proteins to improve folding

• Duration: 4-16 hours depending on temperature

Purification Protocol:

• Harvest cells by centrifugation (5,000 × g, 10 min, 4°C)

• Resuspend in lysis buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1% detergent (e.g., n-dodecyl-β-D-maltoside), and protease inhibitors

• Lyse cells using sonication or pressure-based methods

• Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

• Bind to Ni-NTA resin for 1-2 hours at 4°C

• Wash with buffer containing 20-30 mM imidazole

• Elute with buffer containing 250-300 mM imidazole

• Dialyze against storage buffer (Tris/PBS-based buffer, pH 8.0 with 6% trehalose)

Storage Recommendations:

• Store purified protein at -20°C/-80°C

• Add glycerol to a final concentration of 5-50% (optimally 50%)

• Avoid repeated freeze-thaw cycles

• For working stocks, store aliquots at 4°C for up to one week

How can researchers effectively reconstitute lyophilized At4g15620 protein for experimental use?

To ensure optimal protein activity and stability when reconstituting lyophilized At4g15620 protein:

• Briefly centrifuge the vial before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Allow protein to dissolve completely by gentle mixing, avoiding vigorous shaking that may cause denaturation

• For long-term storage, add glycerol to a final concentration of 50%

• Aliquot into small volumes to prevent multiple freeze-thaw cycles

• Validate protein integrity by SDS-PAGE before experimental use

Table 1: Recommended Reconstitution and Storage Conditions

What experimental designs are most effective for studying At4g15620 function in drought response?

Based on drought response studies in Arabidopsis, the following experimental approaches are recommended:

In Vitro Plate Assays:

• Vertical agar plate system with controlled water availability:

  • Prepare plates with varying water content (e.g., 100%, 80%, 60%, 40%)

  • For 80% water content: use 60 mL of 2.5% agar and 1.25× LS media

  • Grow seedlings for 8 days on standard media before transferring to treatment plates

  • Maintain plants on treatment plates for 14 days

Plant Tissue Analysis:

• Harvest shoots and roots separately 2 hours after subjective dawn

• Flash-freeze samples immediately (6 plants per replicate for statistical power)

• Extract RNA using standard protocols for transcriptomic analysis

• Measure dry weight to quantify biomass effects

Expression Analysis:

• Design specific primers for At4g15620

• Use RT-qPCR to measure expression changes

• Consider RNA-Seq for genome-wide context

Genetic Approaches:

• Compare wild-type with At4g15620 knockout/knockdown lines

• Complement mutant lines with the native or modified At4g15620 gene

• Create promoter-reporter fusions to monitor expression patterns

Data Analysis:

• Use linear models to identify drought-responsive genes

• Require expression recovery upon rewatering to confirm genuine drought response

• Compare results with field condition responses for ecological relevance

How does At4g15620 compare functionally with other CASP family proteins in Arabidopsis?

Comparative analysis between At4g15620 (AtCASPL1E2) and other CASP family proteins requires several methodological approaches:

Sequence and Structure Comparison:

• Multiple sequence alignment of all CASP and CASP-like proteins in Arabidopsis

• Phylogenetic analysis to determine evolutionary relationships

• Protein domain prediction to identify conserved functional motifs

• 3D structure modeling and comparison where possible

Expression Pattern Analysis:

• Compare tissue-specific expression profiles using public transcriptomic datasets

• Analyze co-expression networks to identify functional associations

• Examine expression under various stress conditions (drought, hypoxia, etc.)

Functional Complementation:

• Express At4g15620 in mutants of other CASP genes to test functional redundancy

• Create domain-swapped chimeric proteins to identify functional domains

• Perform subcellular localization studies to determine if different CASP proteins target the same cellular compartments

The expected outcome of these analyses would be a comprehensive understanding of the functional specialization or redundancy among CASP family members, providing insight into At4g15620's specific role in membrane organization or barrier formation.

What methods are most effective for studying protein-protein interactions involving At4g15620?

Given the membrane-associated nature of At4g15620, specialized techniques are required for studying its protein-protein interactions:

Co-immunoprecipitation (Co-IP):

• Express His-tagged At4g15620 in planta or appropriate expression system

• Solubilize membranes using mild detergents (e.g., digitonin, n-dodecyl-β-D-maltoside)

• Purify using anti-His antibodies or Ni-NTA resin

• Identify interacting partners by mass spectrometry

• Validate interactions by reciprocal Co-IP

Membrane Yeast Two-Hybrid (MYTH):

• Clone At4g15620 into appropriate MYTH vectors

• Screen against Arabidopsis cDNA library

• Confirm positive interactions through secondary screens

• Validate in planta using BiFC or Co-IP

Bimolecular Fluorescence Complementation (BiFC):

• Create fusion constructs of At4g15620 and candidate interacting proteins with split fluorescent protein fragments

• Express in Arabidopsis protoplasts or Nicotiana benthamiana leaves

• Observe reconstituted fluorescence using confocal microscopy

• Quantify interaction strength by measuring fluorescence intensity

Proximity-Dependent Biotin Identification (BioID):

• Generate fusion of At4g15620 with a promiscuous biotin ligase

• Express in Arabidopsis

• Purify biotinylated proteins

• Identify by mass spectrometry

When interpreting results, researchers should consider that membrane protein interactions may be transient or dependent on specific lipid environments, requiring careful experimental design and controls.

How can researchers analyze transcriptomic changes of At4g15620 under hypoxic conditions?

To effectively analyze At4g15620 expression under hypoxic conditions, researchers should implement the following methodological approach:

Experimental Design:

• Include multiple hypoxia treatments:

  • Direct hypoxia (low oxygen atmosphere)

  • Submergence (complete plant immersion)

  • Waterlogging (root zone immersion)

• Use time-course sampling to capture both early and late responses

• Include tissue-specific sampling (roots and shoots separately)

• Ensure adequate biological replication (minimum 3 replicates)

RNA-Seq Analysis Workflow:

• Extract high-quality RNA from treated samples

• Perform quality control using RNA integrity metrics

• Sequence using Illumina platform for compatibility with meta-analyses

• Process raw data through standard bioinformatics pipeline:

  • Quality filtering

  • Alignment to Arabidopsis reference genome (TAIR10)

  • Quantification of transcript abundance

  • Differential expression analysis using DESeq2 or similar tool

Meta-analysis Integration:

• Compare results with public hypoxia datasets

• Identify genes consistently co-regulated with At4g15620

• Perform GO enrichment analysis on co-regulated gene sets

• Search for conserved promoter elements in co-regulated genes

Validation:

• Confirm expression changes by RT-qPCR

• Test protein-level changes by western blot if antibodies are available

• Analyze promoter activity using reporter constructs

This approach allows researchers to place At4g15620 in the context of broader hypoxia response networks and identify potential regulatory mechanisms controlling its expression.

How should researchers address contradictory expression data for At4g15620 across different studies?

When encountering contradictory expression data for At4g15620 across different studies, researchers should implement a systematic resolution approach:

Meta-analysis Methodology:

• Systematically collect all relevant studies reporting At4g15620 expression

• Standardize data formats and normalization methods

• Implement effect size calculations to make studies comparable

• Perform forest plot analysis to visualize contradictions and consistencies

• Apply random-effects modeling to account for between-study heterogeneity

Variable Identification:

• Create a comprehensive table documenting experimental conditions:

  • Plant age and developmental stage

  • Growth conditions (light, temperature, media composition)

  • Tissue sampled and sampling time

  • Treatment details (concentration, duration, application method)

  • Arabidopsis ecotype used (e.g., Col-0)

  • RNA extraction and analysis methods

Validation Experiments:

• Design targeted experiments to test specific contradictions

• Use multiple analytical techniques (RT-qPCR, RNA-Seq, protein detection)

• Include positive and negative controls

• Test multiple Arabidopsis accessions if ecotype-specific responses are suspected

Biological Context Analysis:

• Consider gene networks rather than isolated gene expression

• Examine if contradictions reflect biological plasticity rather than technical issues

• Investigate potential post-transcriptional regulation

Table 2: Common Sources of Contradictory Expression Data and Resolution Strategies

What statistical approaches are most appropriate for analyzing differential expression of At4g15620?

For robust statistical analysis of At4g15620 differential expression, the following methodological approaches are recommended:

For RNA-Seq Data:

• Preprocessing:

  • Quality control using FastQC

  • Read trimming and filtering for high-quality data

  • Alignment to reference genome using STAR or HISAT2

  • Quantification at gene and transcript level using tools like featureCounts or Salmon

• Differential Expression Analysis:

  • Use DESeq2 or edgeR for count-based statistical modeling

  • Apply linear models for multi-factor experimental designs

  • Control for false discovery using Benjamini-Hochberg procedure

  • Set appropriate significance thresholds (typically adj. p-value < 0.05)

• Validation:

  • Compare results across multiple statistical methods

  • Verify key findings with RT-qPCR

  • Consider biological significance alongside statistical significance

For Time-Series Analysis:

• Apply specialized time-series methods:

  • maSigPro for identifying significant temporal patterns

  • autoregressive models for capturing temporal dependencies

  • functional data analysis for smooth trajectory modeling

• Recovery-based confirmation:

  • Verify genuine responses by requiring expression recovery after stress removal

  • Implement before-during-after experimental designs

For Multi-Stress Comparison:

• Meta-analysis approaches:

  • Calculate standardized effect sizes

  • Use random-effects models to account for heterogeneity

  • Apply rank-based methods for cross-study normalization

• Pathway and network analysis:

  • Place At4g15620 in context of broader response networks

  • Use weighted gene co-expression network analysis (WGCNA)

  • Apply gene set enrichment analysis (GSEA)

Sample Size Considerations:

• For detecting moderate expression changes: minimum 3-4 biological replicates

• For detecting subtle changes: 5+ biological replicates recommended

• For time series: balance between sampling density and replication

How might At4g15620 function be leveraged in agricultural applications for drought resistance?

The potential agricultural applications of At4g15620 for improving drought resistance require specific research approaches:

Translational Research Methodology:

• Confirm At4g15620 function in drought response:

  • Create overexpression and knockout lines

  • Test drought tolerance using standardized protocols

  • Measure physiological parameters (water use efficiency, stomatal conductance)

  • Assess impact on yield components under water-limited conditions

• Cross-species functional conservation analysis:

  • Identify orthologs in crop species using bioinformatics

  • Assess expression patterns of orthologs under drought

  • Create transgenic crops expressing modified At4g15620

  • Test in controlled environment and field conditions

• Mechanistic understanding:

  • Determine cellular and molecular mechanisms of drought resistance

  • Identify downstream targets and pathways

  • Investigate potential for tissue-specific expression optimization

• Breeding applications:

  • Develop molecular markers associated with favorable At4g15620 alleles

  • Screen germplasm collections for natural variation

  • Implement marker-assisted selection or genome editing

The research should utilize the standardized drought simulation protocols established for Arabidopsis, including the vertical plate assay with controlled water availability , as well as pot-based drought treatments that more closely mimic field conditions. When translating to crop species, researchers should validate that the drought response mechanisms are conserved.

What cutting-edge techniques are emerging for studying membrane proteins like At4g15620?

Recent methodological advances offer new opportunities for studying membrane proteins like At4g15620:

Structural Biology Approaches:

• Cryo-electron microscopy (cryo-EM):

  • Single-particle analysis for purified protein

  • Tomography for in situ structural determination

  • Sample preparation using nanodiscs or amphipols

• Advanced crystallography methods:

  • Lipidic cubic phase crystallization

  • X-ray free-electron laser (XFEL) crystallography

  • Microcrystal electron diffraction (MicroED)

Protein Dynamics and Interactions:

• Single-molecule techniques:

  • Fluorescence resonance energy transfer (FRET)

  • High-speed atomic force microscopy (HS-AFM)

  • Single-molecule tracking in living cells

• Advanced interaction mapping:

  • Thermal proximity coaggregation (TPCA)

  • Cross-linking mass spectrometry (XL-MS)

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

Functional Characterization:

• Advanced imaging:

  • Super-resolution microscopy (PALM, STORM, SIM)

  • Correlative light and electron microscopy (CLEM)

  • Label-free techniques (Raman microscopy)

• Genome engineering:

  • CRISPR-Cas9 for precise genomic modification

  • Base editing for single nucleotide changes

  • Prime editing for targeted insertions/deletions

• Proteomics:

  • Targeted proteomics using parallel reaction monitoring (PRM)

  • Spatial proteomics for subcellular localization

  • Protein turnover analysis using pulsed stable isotope labeling

Implementation of these techniques requires specialized equipment and expertise but offers unprecedented insights into membrane protein structure, dynamics, and function that could resolve longstanding questions about CASP-like proteins.

What are the most promising research directions for understanding At4g15620 function?

Based on current knowledge and methodological capabilities, the following research directions hold the most promise for advancing our understanding of At4g15620:

• Integrative multi-omics approaches combining:

  • Transcriptomics data from stress conditions (drought, hypoxia)

  • Proteomics to identify interaction partners

  • Metabolomics to detect physiological changes

  • Phenomics for whole-plant functional assessment

• Structure-function relationship studies:

  • Detailed structural characterization using advanced techniques

  • Systematic mutagenesis of conserved domains

  • In vitro reconstitution systems to test membrane functions

• Comparative studies across species:

  • Evolutionary analysis of CASP-like proteins

  • Functional conservation testing in crop species

  • Identification of natural variation associated with stress tolerance

• Systems biology approaches:

  • Network modeling to place At4g15620 in broader cellular contexts

  • Machine learning to predict functional associations

  • Integrative analysis with publicly available datasets

These research directions should be pursued using standardized methodologies for protein expression and purification , stress treatments , and transcriptomic analysis to ensure reproducibility and comparability across studies. The development of specific antibodies and reporter lines would significantly accelerate research progress in this field.