Recombinant Arabidopsis thaliana CASP-like protein At4g15630 (At4g15630)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Arabidopsis thaliana CASP-like protein At4g15630 (At4g15630) is a member of the Casparian strip membrane domain protein (CASP) family, which plays critical roles in plant membrane scaffolding and cell wall modification . This protein, encoded by the At4g15630 gene, is classified under the DUF588 (PF04535) domain family and shares structural homology with MARVEL (MAL and related proteins for vesicle trafficking and membrane link) proteins . Recombinant production of At4g15630 enables biochemical and functional studies, particularly in understanding its role in stress responses and membrane dynamics .

Genomic and Physicochemical Properties

  • Gene ID: At4g15630 (UniProt ID: Q8L8Z1) .

  • Synonyms: CASPL1E1, Dl3855w, FCAALL.230 .

  • Protein Length: 190 amino acids .

  • Molecular Weight: ~20–21 kDa (calculated) .

  • Theoretical pI: ~4.2–5.0 .

  • Transmembrane Domains: Four predicted transmembrane helices (residues 45–67, 87–109, 130–149, and 169–191) .

PropertyValue
Gene LocationChromosome 4 (Arabidopsis thaliana)
Protein FamilyCASP-like (DUF588)
Expression SystemEscherichia coli (recombinant)
Purification TagN-terminal His tag
StabilityLyophilized or stored in 50% glycerol

Evolutionary Conservation

At4g15630 belongs to a lineage of CASPL proteins conserved across land plants and green algae, with homologs identified in Oryza sativa (rice) and Citrullus lanatus (watermelon) . Phylogenetic analysis clusters CASPLs into six subfamilies, with At4g15630 falling into the CASP_like-IV subgroup .

Role in Membrane Scaffolding

  • At4g15630 localizes to the plasma membrane and shares structural features with CASPs, which form diffusion barriers in the endodermis .

  • Like CASPs, it may mediate membrane domain formation through conserved transmembrane residues (e.g., Arg in TM1 and Asp in TM3) .

  • Deletion mutagenesis revealed that extracellular loops (EL1 and EL2) are dispensable for membrane localization, but specific residues (e.g., Trp164) influence domain stability .

Stress Response and Growth Regulation

  • Orthologs of At4g15630, such as ClCASPL in watermelon, are cold-inducible and affect stress tolerance .

  • Knockout mutants of AtCASPL4C1 (a close homolog) exhibit accelerated growth, increased biomass, and enhanced cold tolerance, suggesting a regulatory role in stress adaptation .

Expression Systems

  • Host: Escherichia coli .

  • Yield: Up to 0.4 mg protein per gram fresh weight in optimized Arabidopsis systems .

  • Purification: Nickel affinity chromatography under denaturing conditions .

Research Findings and Implications

  • Membrane Proteomics: At4g15630 was identified in Arabidopsis glucosinolate mutants, suggesting a role in defense-related membrane processes .

  • Evolutionary Divergence: CASPL genes in Arabidopsis and rice underwent purifying selection, with Ka/Ks ratios <1 in most homologs .

  • Biotechnological Potential: Recombinant At4g15630 serves as a model for studying CASPL-mediated membrane dynamics and stress signaling .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly specify your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
The delivery time may vary depending on the purchase method and location. For specific delivery timeframes, kindly consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Should you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
At4g15630; Dl3855w; FCAALL.230; CASP-like protein 1E1; AtCASPL1E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g15630
Target Protein Sequence
MEHESKNKVDGMEMEKGKKESGSRKGLELTMRVLALVLTMVAATVLGVAKQTKVVPIKLI PTLPPLNVSTTAKASYLSAFVYNISANAIACGYTAISIVIVMISKGKRSKSLLMAVLIGD LMMVALLFSSTGAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQAAVSVAITLIASVVFML LVVLDALKLP
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G15630

STRING: 3702.AT4G15630.1

UniGene: At.33161

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the CASP protein family in Arabidopsis thaliana and how is At4g15630 classified within this family?

The Casparian strip membrane domain (CASP) protein family in Arabidopsis thaliana consists of approximately 39 genes that are defined as members of the CASP family (UPF0497). Within this family, CASP1/2/3/4/5 have been identified to be directly associated with Casparian strip formation in plant roots . At4g15630 belongs to the CASP-like (CASPL) proteins, which share structural similarities with the canonical CASP proteins but may have divergent functions. Phylogenetic analysis has grouped the CASP family into 6 distinct subfamilies based on sequence similarity . While the search results focus primarily on AtCASPL4C1 (At3g55390), the classification method is applicable to understanding where At4g15630 fits within this protein family.

What is the predicted structural organization of CASP-like proteins like At4g15630?

CASP-like proteins in Arabidopsis thaliana typically contain four transmembrane (TM) domains. As demonstrated with related CASPL proteins, these transmembrane domains are approximately 20-22 amino acids in length and are predicted to anchor the protein within the plasma membrane . For example, in the related AtCASPL4C1 protein, these domains were located at amino acid positions 36-56, 78-98, 119-139, and 160-180 . The predicted structure of At4g15630 would follow a similar organization, with four transmembrane domains creating a protein that is firmly embedded in the plasma membrane, potentially creating specialized membrane domains.

What expression patterns are observed for CASP-like proteins in Arabidopsis tissues?

While specific expression data for At4g15630 is not directly provided in the search results, studies of related CASP-like proteins provide insights into typical expression patterns. For instance, AtCASPL4C1 shows widespread expression throughout various plant organs and tissues based on β-glucuronidase (GUS) reporter analysis . Unlike the canonical CASP proteins that are primarily expressed in the root endodermis, CASP-like proteins often show expression in multiple tissue types, suggesting functions beyond Casparian strip formation. Studies of CASP-like genes have revealed expression patterns particularly in vascular tissues, indicating potential roles in vascular development or function .

What are the most effective protocols for recombinant expression of At4g15630 and other CASP-like proteins?

For recombinant expression of transmembrane proteins like At4g15630, researchers should consider the following methodological approach:

  • Vector selection: Choose expression vectors with strong promoters compatible with plant studies (e.g., 35S promoter for plant expression or T7 promoter for bacterial systems).

  • Expression system optimization: For membrane proteins like CASP-like proteins, expression in systems capable of proper membrane protein folding is crucial. Options include:

    • E. coli strains optimized for membrane proteins

    • Yeast expression systems

    • Insect cell expression systems

    • Plant-based transient expression systems

  • Fusion tag selection: Addition of tags like GFP can facilitate localization studies, as demonstrated with ClCASPL-GFP, which was shown to localize to the plasma membrane .

  • Purification strategy: For transmembrane proteins, detergent screening is essential to identify conditions that maintain protein stability and function during extraction from membranes.

  • Functional verification: Activity assays or interaction studies to confirm that the recombinant protein retains its biological properties.

The specific optimization parameters would need to be determined empirically for At4g15630, as membrane protein expression is highly protein-dependent.

What techniques are most suitable for studying the subcellular localization of At4g15630?

Based on research approaches used for related CASP-like proteins, the following techniques are recommended for studying At4g15630 subcellular localization:

  • Fluorescent protein fusion: Creating GFP-tagged versions of At4g15630 for visualization in living cells. This approach was successfully used with ClCASPL-GFP to demonstrate plasma membrane localization .

  • Confocal microscopy protocols:

    • Fixed cell imaging using 4% paraformaldehyde fixation

    • Live cell imaging with appropriate mounting media

    • Z-stack acquisition to capture membrane localization patterns

    • Co-localization studies with established membrane markers

  • Immunolocalization: Using specific antibodies against At4g15630 coupled with immunofluorescence microscopy when direct fusion constructs might affect protein function.

  • Subcellular fractionation: Biochemical separation of cellular components followed by Western blot analysis to confirm membrane association.

  • Membrane topology analysis: Protease protection assays or selective permeabilization techniques to determine protein orientation within the membrane.

For transmembrane proteins like At4g15630, careful attention to membrane preservation during sample preparation is essential for accurate localization studies.

How can researchers effectively generate and phenotype At4g15630 knockout or overexpression lines?

To generate and properly phenotype At4g15630 transgenic lines, researchers should follow these methodological approaches:

For knockout generation:

  • T-DNA insertion lines: Obtain existing T-DNA insertion lines from repositories like ABRC (Arabidopsis Biological Resource Center), similar to the approach used for AtCASPL4C1 studies .

  • CRISPR-Cas9 targeting: Design guide RNAs specific to At4g15630 for targeted mutagenesis if T-DNA lines are not available.

  • Verification of knockout: Confirm gene disruption through:

    • RT-PCR to verify absence of transcript

    • qPCR for quantitative assessment of expression levels

    • Western blotting to confirm protein absence

For overexpression lines:

  • Vector construction: Generate constructs with At4g15630 under the control of constitutive promoters like 35S.

  • Transformation: Use Agrobacterium-mediated transformation of Arabidopsis plants.

  • Selection and verification: Select transformants and confirm overexpression through RT-PCR and Western blotting.

Phenotyping protocol:

  • Growth analysis: Measure parameters including:

    • Primary root length

    • Rosette size and leaf number

    • Biomass (fresh and dry weight)

    • Time to flowering

    • Plant height

  • Stress response evaluation: Based on findings with related CASP-like proteins, particularly test:

    • Cold stress tolerance (e.g., exposure to 10°C for 7-10 days)

    • Other abiotic stresses (drought, salt, heat)

  • Microscopic analysis:

    • Examine Casparian strip formation using lignin staining techniques

    • Analyze vascular tissue development and organization

  • Molecular phenotyping:

    • RNA-seq or microarray analysis to identify altered gene expression patterns

    • qPCR validation of key regulatory genes

This comprehensive phenotyping approach would reveal both obvious morphological changes and subtle molecular alterations resulting from manipulation of At4g15630 expression.

What is the role of At4g15630 and other CASP-like proteins in plant stress responses?

Based on studies of related CASP-like proteins, these proteins appear to play significant roles in plant stress responses, particularly to cold stress:

  • Cold stress regulation: Research on the related AtCASPL4C1 demonstrated that knockout plants exhibited enhanced tolerance to cold stress, while overexpression of the watermelon ortholog (ClCASPL) increased cold sensitivity in Arabidopsis . This suggests that CASP-like proteins like At4g15630 may function as negative regulators of cold tolerance.

  • Cold stress phenotypes: When exposed to cold conditions (10°C for 7-10 days), AtCASPL4C1 knockout plants displayed:

    • Significantly longer primary root length

    • Enhanced growth compared to wild-type plants

    • Higher chlorophyll fluorescence parameters

    • Greater number of rosette leaves

    • Increased biomass

  • Transcriptional regulation: CASP-like genes show stress-responsive expression patterns. For example, AtCASPL4C1 was induced by cold stress, with peak expression occurring 48 hours after cold treatment . Similar transcriptional regulation might be expected for At4g15630 under various stress conditions.

  • Broad stress response: Transcriptomic analysis revealed that many CASP and CASP-like genes are significantly up-regulated or down-regulated in response to various abiotic stresses beyond just cold . This suggests At4g15630 may participate in multiple stress response pathways.

The stress response functions of CASP-like proteins appear to extend beyond their structural roles in membrane organization, potentially involving signaling or transport functions that affect plant adaptation to environmental challenges.

How does At4g15630 differ functionally from canonical CASP proteins involved in Casparian strip formation?

While canonical CASP proteins (CASP1-5) are directly involved in Casparian strip formation in the root endodermis, CASP-like proteins like At4g15630 appear to have divergent functions:

  • Expression domain differences: Unlike CASP1-5, which are primarily expressed in the root endodermis, CASP-like proteins often show broader expression patterns across multiple tissues and organs . This expanded expression domain suggests functions beyond Casparian strip formation.

  • Limited effect on Casparian strip development: Studies of the related AtCASPL4C1 knockout plants showed no significant alterations in Casparian strip formation in roots, as assessed by lignin staining . This suggests that while structurally similar to canonical CASPs, proteins like At4g15630 likely serve different primary functions.

  • Growth regulation: CASP-like proteins appear to regulate plant growth and development more broadly. For example, AtCASPL4C1 knockout plants showed faster growth, increased biomass, and earlier flowering compared to wild-type plants . These phenotypes are not directly related to Casparian strip formation.

  • Vascular tissue function: The expression of CASP-like genes in vascular tissues suggests a potential role in vascular development or function that is distinct from the endodermal-specific role of canonical CASPs .

  • Membrane organization beyond the Casparian strip: While CASP proteins create specialized membrane domains at the Casparian strip, CASP-like proteins may organize other plasma membrane domains in different cell types, as suggested by their protein structure and membrane localization .

These functional distinctions highlight the evolutionary diversification within the CASP/CASP-like protein family, with proteins like At4g15630 potentially acquiring new functions while retaining structural similarities to their Casparian strip-forming relatives.

What protein-protein interactions have been identified for CASP-like proteins such as At4g15630?

While the search results do not directly address protein-protein interactions for At4g15630 specifically, research on related CASP family proteins provides insights into potential interaction partners and networks:

  • Membrane domain organization: Canonical CASP proteins form a membrane scaffold that recruits the lignin polymerization machinery to specific plasma membrane domains during Casparian strip formation . CASP-like proteins may similarly participate in membrane domain organization through protein-protein interactions.

  • Potential interacting partners: Based on functions of related CASP-like proteins, At4g15630 might interact with:

    • Other membrane proteins involved in stress responses

    • Signaling proteins in cold stress response pathways

    • Components of the plant's vascular development machinery

    • Proteins involved in lignin biosynthesis or deposition

  • Investigation methods: To identify protein-protein interactions for At4g15630, researchers should consider:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Split-GFP or FRET-based interaction assays

    • Proximity labeling techniques like BioID or APEX

Understanding the protein interaction network of At4g15630 would provide critical insights into its molecular function and the mechanisms through which it influences plant growth and stress responses.

How do CASP-like proteins like At4g15630 contribute to plant phenotypic plasticity in response to environmental changes?

CASP-like proteins appear to play significant roles in mediating plant phenotypic plasticity in response to environmental challenges:

  • Growth regulation under stress: Studies of AtCASPL4C1 revealed that this CASP-like protein negatively regulates growth under cold stress conditions . Knockout plants showed enhanced growth under cold stress, suggesting that modulation of CASP-like protein activity allows plants to adjust growth patterns in response to environmental conditions.

  • Developmental timing adjustment: AtCASPL4C1 knockout plants exhibited earlier flowering compared to wild-type plants , indicating that CASP-like proteins may influence developmental transitions in response to environmental cues.

  • Tissue-specific responses: The expression of CASP-like genes in various tissues suggests that they might mediate tissue-specific adaptive responses to environmental changes . In particular, their presence in vascular tissues may allow for coordinated whole-plant responses to environmental challenges.

  • Cellular membrane adaptations: As membrane proteins, CASP-like proteins could influence membrane properties or organization in response to environmental stresses, particularly temperature changes that affect membrane fluidity.

  • Signaling network integration: The stress-responsive expression patterns of CASP-like genes suggest they may function within signaling networks that sense environmental changes and trigger appropriate developmental or physiological responses .

These functions collectively position CASP-like proteins like At4g15630 as potential regulatory components in the complex mechanisms by which plants adjust their growth and development in response to changing environmental conditions.

What are the molecular mechanisms by which At4g15630 and other CASP-like proteins regulate plant growth and stress responses?

Based on research with related CASP-like proteins, several potential molecular mechanisms may explain how At4g15630 could regulate plant growth and stress responses:

  • Membrane domain organization: CASP-like proteins may establish specialized plasma membrane domains that influence:

    • Membrane transporter localization or activity

    • Signaling protein clustering or compartmentalization

    • Cell wall-plasma membrane connections that affect growth

  • Transcriptional regulation network: Studies of AtCASPL4C1 revealed that its absence altered the expression of other CASP family genes, particularly increasing the transcript abundance of CASP1, CASP2, CASP3, CASP4, and CASP5 . This suggests CASP-like proteins may participate in transcriptional feedback loops that regulate multiple developmental and stress response pathways.

  • Growth hormone signaling modulation: The enhanced growth phenotypes observed in AtCASPL4C1 knockout plants suggest these proteins may interact with or influence growth hormone signaling pathways, such as auxin, gibberellin, or brassinosteroid pathways.

  • Cold response pathway integration: The cold-inducible nature of CASP-like genes and their influence on cold tolerance suggests they may interface with established cold response pathways, potentially through:

    • Interactions with cold-sensing mechanisms

    • Modulation of CBF (C-repeat binding factor) transcription factor activity

    • Alteration of membrane properties that affect cold perception

  • Vascular tissue function: The expression of CASP-like genes in vascular tissues suggests they may influence:

    • Vascular development or differentiation

    • Transport of hormones, nutrients, or signaling molecules through the vasculature

    • Vascular responses to environmental stresses

Understanding these molecular mechanisms would provide valuable insights into how At4g15630 contributes to plant growth regulation and environmental adaptation.

What evolutionary patterns are observed in the CASP protein family and how do they relate to functional diversification?

The evolutionary analysis of the CASP protein family reveals interesting patterns that likely underlie functional diversification:

  • Phylogenetic organization: The CASP family in Arabidopsis has been classified into 6 distinct subfamilies based on sequence similarity using the Neighbor-Joining method . This classification suggests multiple gene duplication events followed by functional divergence during plant evolution.

  • Functional specialization: Within this family:

    • A small subset (CASP1-5) has specialized for Casparian strip formation

    • Other members like AtCASPL4C1 have evolved roles in growth regulation and stress responses

    • Further subfamilies may have acquired other specialized functions

  • Conservation across species: The identification of orthologs between distantly related species (e.g., between Arabidopsis and watermelon) suggests that certain CASP-like proteins perform evolutionarily conserved functions . For example, both ClCASPL from watermelon and AtCASPL4C1 from Arabidopsis appear to regulate cold tolerance.

  • Structural conservation vs. functional divergence: Despite functional diversification, the basic structural features of CASP-like proteins (four transmembrane domains) remain conserved across the family . This suggests that their membrane organization function has been adapted for different cellular contexts.

  • Expression pattern evolution: The expansion of expression domains from root-specific (canonical CASPs) to broadly expressed patterns (many CASP-like proteins) indicates regulatory evolution that has enabled new functions .

Understanding the evolutionary trajectory of the CASP family provides context for the specific functions of At4g15630 and helps predict its potential roles based on its position within the evolutionary tree of this protein family.

What omics-based approaches could advance our understanding of At4g15630 function?

Several omics-based approaches would be valuable for elucidating the function of At4g15630:

  • Transcriptomics:

    • RNA-seq analysis comparing wild-type, knockout, and overexpression lines of At4g15630 under normal and stress conditions

    • Single-cell RNA-seq to identify cell-type-specific responses to At4g15630 manipulation

    • Time-course expression analysis during development and stress responses

  • Proteomics:

    • Quantitative proteomics comparing protein abundance changes in At4g15630 modified lines

    • Phosphoproteomics to identify signaling pathways affected by At4g15630

    • Membrane proteomics focusing on plasma membrane composition changes

  • Metabolomics:

    • Targeted and untargeted metabolite profiling to identify metabolic pathways influenced by At4g15630

    • Lipid profiling to examine potential effects on membrane composition

  • Interactomics:

    • Protein-protein interaction studies using immunoprecipitation-mass spectrometry

    • Yeast two-hybrid or split-ubiquitin screens to identify direct interaction partners

    • Proximity labeling approaches (BioID/APEX) to identify proximal proteins in living cells

  • Multi-omics integration:

    • Integration of transcriptomic, proteomic, and metabolomic data to build comprehensive regulatory networks

    • Correlation analysis between molecular changes and phenotypic outcomes

These approaches would generate comprehensive datasets that could reveal the molecular mechanisms through which At4g15630 influences plant growth and stress responses.

How might CASP-like proteins like At4g15630 be utilized in developing climate-resilient crops?

Based on the known functions of CASP-like proteins in stress responses, particularly cold tolerance, there are several potential applications for crop improvement:

  • Enhanced cold tolerance strategies:

    • Down-regulation of negative regulators of cold tolerance (like AtCASPL4C1) could enhance crop resilience to cold stress

    • Targeted breeding for natural variants with optimized CASP-like protein activity

    • Gene editing of CASP-like genes to enhance cold tolerance while maintaining yield potential

  • Growth-stress tolerance balance optimization:

    • Fine-tuning CASP-like protein expression to balance growth and stress resilience

    • Tissue-specific or stress-inducible modification of CASP-like gene expression

    • Identification of natural allelic variants that provide optimal combinations of vigor and stress tolerance

  • Molecular marker development:

    • Development of markers based on CASP-like gene variants for marker-assisted selection in breeding programs

    • QTL analysis incorporating CASP-like genes to identify beneficial haplotypes

  • Transgenic approaches:

    • Creation of temperature-responsive expression systems using CASP-like gene promoters

    • Engineering of modified CASP-like proteins with enhanced or novel functions

  • Guided breeding strategies:

    • Cross-species comparative analysis to identify optimal CASP-like alleles in crop relatives

    • Introgression of beneficial CASP-like genes from wild relatives with enhanced stress tolerance

These approaches would leverage the natural functions of CASP-like proteins in stress adaptation to develop crops better suited to challenging and changing climatic conditions.

What are the challenges in translating fundamental knowledge about At4g15630 to applied agricultural research?

Several challenges exist in translating basic research on CASP-like proteins to agricultural applications:

  • Functional redundancy issues:

    • The large CASP protein family (39 members in Arabidopsis) likely exhibits functional redundancy

    • Single gene modifications may have limited phenotypic effects due to compensation by related genes

    • Multiple gene modifications may be required for significant phenotypic changes

  • Growth-stress tolerance trade-offs:

    • Modifications enhancing stress tolerance often come with growth penalties

    • The negative regulation of growth by some CASP-like proteins under stress conditions suggests complex trade-offs

    • Optimizing both growth and stress tolerance requires precise gene regulation

  • Species-specific functions:

    • Functions established in Arabidopsis may not translate directly to crop species

    • Crop-specific studies would be needed to validate CASP-like protein functions

    • Evolutionary divergence may have led to different functions in different species

  • Environmental variability considerations:

    • Field conditions are more variable than controlled laboratory settings

    • Beneficial effects of CASP-like protein modifications may be environment-dependent

    • Multi-environment testing would be required to ensure broad adaptability

  • Regulatory and public acceptance hurdles:

    • Genetic modification approaches face regulatory barriers

    • Public acceptance issues for genetically engineered crops

    • Need for non-GMO approaches such as targeted breeding or TILLING

Addressing these challenges requires integrative approaches that combine fundamental mechanistic understanding with applied agricultural research in relevant crop species and environments.

Gene Expression Changes in Response to Cold Stress

GeneExpression Change After Cold TreatmentPeak Expression TimingTissues With Highest Expression
AtCASPL4C1Significant upregulation48 hours after cold treatmentVascular tissues, various organs
Other CASP family genesVariable (up/down regulation)Varies by specific genePrimarily root endodermis for CASP1-5

Note: This table is based on data from studies of AtCASPL4C1 , which serves as a model for understanding potential expression patterns of At4g15630.

Phenotypic Comparison of CASP-like Gene Modifications

Phenotypic ParameterWild-TypeCASPL KnockoutCASPL Overexpression
Growth Parameters (Normal Conditions)
Primary Root LengthBaselineIncreasedDecreased
Biomass (Dry Weight)BaselineSignificantly increasedDecreased
Flowering TimeBaselineEarlier floweringDelayed flowering
Cold Stress Response (10°C for 7-10 days)
Growth Under ColdBaselineEnhanced growthReduced growth
Chlorophyll FluorescenceBaselineHigher parametersLower parameters
Rosette Leaf NumberBaselineGreater numberReduced number
Casparian Strip Formation
Lignin Staining in EndodermisNormal patternNo significant alterationNo significant alteration

Note: This table summarizes findings from AtCASPL4C1 studies , which provide a model for potential phenotypic effects of At4g15630 modification.

Transcript Abundance of CASP Genes in Different Genetic Backgrounds

GeneExpression in Wild-TypeExpression in CASPL KnockoutExpression in CASPL Overexpression
CASP1BaselineSignificantly increasedReduced
CASP2BaselineSignificantly increasedNo significant change
CASP3BaselineSignificantly increasedNo significant change
CASP4BaselineSignificantly increasedNo significant change
CASP5BaselineSignificantly increasedNo significant change

Note: This table is based on data from AtCASPL4C1 studies , showing how modification of one CASP-like gene affects expression of other family members, which may have relevance for understanding At4g15630 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.