Recombinant Arabidopsis thaliana CASP-like protein At4g25040 (At4g25040)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

Recombinant At4g25040 is a full-length protein from the model organism Arabidopsis thaliana, classified as a CASP-like protein (CASPL) . This protein is also known by several synonyms including F13M23.180, CASP-like protein 1F1, and AtCASPL1F1, with the UniProt identification code Q9M0L3 . Within the broader classification system, At4g25040 belongs to the UPF0497 family, which encompasses various CASP and CASP-like proteins organized into distinct subfamilies based on structural and functional similarities .

Membrane Localization and Integration

The At4g25040 protein, like other CASP-like proteins, is primarily localized to the plasma membrane . Recombinant At4g25040 contains structural elements that facilitate its integration into specific membrane domains, potentially contributing to specialized membrane compartmentalization in plant cells. This localization is crucial for its biological functions, allowing it to interact with both cytoplasmic and extracellular components.

Potential Role in Casparian Strip Formation

While the canonical CASP proteins (CASP1-5) are directly involved in Casparian strip formation in the root endodermis, the exact role of At4g25040 in this process remains less defined . The Casparian strip consists primarily of lignin polymers in Arabidopsis and forms a crucial diffusion barrier in roots . Based on structural homology to other CASPLs, At4g25040 may contribute to specialized membrane domain organization related to, but potentially distinct from, classic Casparian strip formation.

Additional Biological Functions

Research on related CASP-like proteins suggests that At4g25040 may have functions beyond Casparian strip formation. For instance, some CASPL proteins have been implicated in cold stress responses and general plant growth regulation . The orthologous gene AtCASPL4C1 in Arabidopsis has been shown to play important roles in cold tolerance, with knock-out plants exhibiting altered growth dynamics, faster growth, increased biomass, and earlier flowering compared to wild type plants . This suggests that CASP-like proteins, including potentially At4g25040, may have broader functions in plant development and stress responses.

Expression Systems and Purification

The recombinant At4g25040 protein is typically expressed in Escherichia coli bacterial systems, with an N-terminal histidine tag to facilitate purification . This approach enables the production of sufficient quantities of protein for various research applications while maintaining the structural integrity necessary for functional studies. The expression in E. coli provides a cost-effective and efficient system for generating this plant protein for diverse experimental purposes.

Physical Properties and Handling

Commercially available recombinant At4g25040 is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . For research applications, proper storage and handling are essential to maintain protein integrity. The protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles that could compromise protein structure and function . Reconstitution is typically performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

Research Applications

Recombinant At4g25040 has various applications in plant biology research, particularly in studies investigating membrane organization, protein-protein interactions, and cellular responses to environmental stresses. The purified protein can be used in biochemical assays, structural studies, and as an antigen for antibody production. Additionally, the recombinant protein provides a valuable tool for investigating the specific functions of At4g25040 in plant cells through in vitro studies.

CASP Protein Family

The CASP protein family in Arabidopsis consists of approximately 39 members organized into six subfamilies based on sequence homology and structural features . The canonical CASP proteins (CASP1-5) are directly involved in Casparian strip formation, mediating the assembly of this specialized cell wall modification in the root endodermis . While At4g25040 shares structural similarities with these proteins, it belongs to a distinct subfamily with potentially different functional properties.

CASP-like Proteins in Different Plant Species

CASP-like proteins have been identified across various plant species, demonstrating evolutionary conservation that suggests important biological functions. For example, a CASP homolog from Lotus japonicus containing the nine-amino acid signature in the first extracellular loop shows expression patterns and localization similar to Arabidopsis CASP1, indicating functional conservation across species . Comparative analysis of At4g25040 with its homologs in other plant species could provide insights into its evolutionary history and functional significance.

Functional Diversity within the CASPL Family

Research on different members of the CASPL family reveals functional diversity beyond Casparian strip formation. For instance, the AtCASPL4C1 gene is widely expressed in various plant organs and is cold-inducible, with knockout plants showing increased tolerance to cold stress . This suggests that different CASPL proteins, potentially including At4g25040, may have specialized roles in stress responses and plant development, contributing to the adaptability of plants to changing environmental conditions.

Current Research Status

Current research on At4g25040 primarily focuses on its structural characterization, expression patterns, and potential functional roles in plant biology. While much has been learned about the general properties of CASP and CASP-like proteins, the specific functions of At4g25040 remain to be fully elucidated. Ongoing research using recombinant protein expression, genetic manipulation, and advanced imaging techniques continues to provide new insights into this protein's biological significance.

Technological Applications

The development of recombinant At4g25040 protein has enabled various technological applications in plant biology research. The availability of purified protein facilitates structural studies, protein-protein interaction analyses, and the development of specific antibodies. These tools are essential for advancing our understanding of At4g25040's functions in plant cells and potentially identifying new applications in agricultural biotechnology.

Future Research Directions

Future research on At4g25040 may focus on several key areas, including:

  1. Detailed structural analysis using advanced imaging techniques

  2. Identification of protein interaction partners and associated signaling pathways

  3. Investigation of its roles in stress responses and plant development

  4. Exploration of potential applications in crop improvement and stress tolerance

These research directions could provide valuable insights into the fundamental biology of CASP-like proteins and their potential applications in agriculture and biotechnology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing it.
Synonyms
At4g25040; F13M23.180; CASP-like protein 1F1; AtCASPL1F1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g25040
Target Protein Sequence
MMGDNEGRRTPLLNLGVQVSMRVLTIGAAMASMWVMITNREVASVYGIAFEAKYSYSSAF RYLVYAQIAVCAATLFTLVWACLAVRRRGLVFALFFFDLLTTLTAISAFSAAFAEGYVGK YGNKQAGWLPICGYVHGYCSRVTISLAMSFASFILLFILTVLTASAARHY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G25040

STRING: 3702.AT4G25040.1

UniGene: At.32300

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In flowers, expressed in the anther wall.

Q&A

What is At4g25040 and which protein family does it belong to?

At4g25040 is a CASP-like protein from Arabidopsis thaliana that belongs to the evolutionarily conserved CASP-like protein family, specifically the CASP-like-I subfamily. This protein shares homology with rice OsCASP_like proteins and clusters within specific phylogenetic clades with proteins involved in transmembrane transport and cell wall modification processes. The CASP (Casparian Strip membrane domain Proteins) family is known to play important roles in forming specialized membrane domains, particularly in root endodermal tissues where they mediate Casparian strip formation.

What are the structural characteristics of At4g25040?

At4g25040 is characterized by its relatively small size compared to other CASP-like proteins. It consists of 170 amino acid residues, making it shorter than the typical range (152-297 residues) observed in other Arabidopsis CASP proteins. This compact structure suggests potential specialized functional adaptations. Like other members of the CASP family, At4g25040 likely contains multiple transmembrane domains that anchor it within cellular membranes, consistent with its proposed role in forming specialized membrane domains and barriers.

How is At4g25040 regulated at the transcriptional level?

The promoter region of At4g25040 contains multiple stress- and hormone-responsive cis-elements that regulate its expression. These include abscisic acid response elements (ABRE), ethylene response elements (ERE), and MYB/MYC binding sites, which are associated with drought and salinity stress responses. This regulatory profile indicates that At4g25040 expression is likely modulated during abiotic stress conditions, consistent with the role of CASP proteins in forming protective barriers that help maintain cellular homeostasis during environmental challenges.

What considerations are important when designing experiments to study At4g25040 function?

When designing experiments to study At4g25040 function, implement blocking strategies to group similar experimental units together, thereby reducing variability within each block. This approach enhances the detection of treatment effects and enables more precise estimates. For instance, when analyzing phenotypic differences between At4g25040 mutant lines and wild-type plants, group plants with similar developmental stages or genetic backgrounds to minimize confounding factors. This experimental design optimization not only improves statistical power but also allows for reliable detection of subtle phenotypic changes with fewer experimental units .

How can I optimize protein expression and purification of recombinant At4g25040?

For optimal expression and purification of recombinant At4g25040, consider using bacterial expression systems with careful temperature control during induction. Since At4g25040 contains predicted transmembrane domains, expression in E. coli may lead to inclusion body formation. To address this, try expressing truncated versions lacking transmembrane domains or use eukaryotic expression systems like yeast or insect cells that better process membrane proteins. For purification, implement a two-step approach using affinity chromatography (e.g., His-tag purification) followed by size exclusion chromatography. Store the purified protein at -20°C/-80°C in small aliquots to maintain functionality, as indicated by standard protocols for similar recombinant proteins.

What methods are effective for analyzing At4g25040 localization in plant cells?

To analyze At4g25040 cellular localization, generate fusion constructs with fluorescent proteins (e.g., GFP) under control of native or constitutive promoters. Transform these constructs into Arabidopsis using standard Agrobacterium-mediated methods. Based on approaches used for related CASP-like proteins, fluorescence microscopy analysis should be conducted on stable transformants to determine subcellular localization. For example, ClCASPL-GFP localization to the plasma membrane was confirmed using fluorescence microscopy, suggesting a similar approach would be effective for At4g25040. Complement microscopy data with biochemical fractionation methods to confirm membrane association and specific membrane microdomain localization .

How can I determine if At4g25040 plays a role in abiotic stress responses?

To evaluate At4g25040's role in abiotic stress responses, implement a comprehensive phenotypic assessment comparing T-DNA knockout mutants, overexpression lines, and wild-type plants under various stress conditions. Based on research with related CASP-like proteins, cold stress tolerance should be a primary focus. Design experiments exposing plants to temperature stress (e.g., 10°C) for 7-10 days and measure multiple physiological parameters including primary root length, biomass accumulation, chlorophyll fluorescence, and developmental timing. Additionally, analyze the expression pattern of At4g25040 under stress conditions using qRT-PCR and promoter-GUS reporter systems to detect tissue-specific induction patterns. This multi-parameter approach will provide robust evidence for stress-response functions .

What approaches can determine if At4g25040 has functions beyond Casparian strip formation?

To investigate functions of At4g25040 beyond Casparian strip formation, implement a multi-faceted approach combining genetic, molecular, and physiological analyses. Generate and characterize knockout and overexpression lines, focusing on phenotypes throughout plant development rather than just root anatomy. Based on findings from AtCASPL4C1 studies, analyze growth dynamics, biomass accumulation, flowering time, and reproductive development. Conduct lignin staining in roots to assess Casparian strip integrity while simultaneously examining expression patterns in non-root tissues using promoter-reporter constructs. Additionally, analyze transcript abundance of other CASP family members to identify potential compensatory mechanisms. This comprehensive approach will reveal broader physiological roles, similar to how AtCASPL4C1 was found to affect plant growth and stress tolerance despite minimal impact on Casparian strip formation .

How does At4g25040 compare functionally with other CASP-like proteins such as AtCASPL4C1?

To compare At4g25040 with other CASP-like proteins like AtCASPL4C1, implement parallel functional analyses using genetic complementation experiments. Generate At4g25040 and AtCASPL4C1 knockout lines, then create transgenic plants expressing each gene under control of the other's promoter to test functional redundancy. Based on AtCASPL4C1 research, comprehensively analyze growth parameters (root length, biomass, flowering time) and stress responses (particularly cold tolerance) for all genotypes. Examine protein-protein interactions through co-immunoprecipitation or yeast two-hybrid assays to identify if these proteins interact with similar partners. Additionally, conduct expression analysis under various stress conditions to determine if regulation patterns overlap. This systematic comparison will reveal functional similarities and differences, similar to how AtCASPL4C1 was found to negatively regulate growth and cold tolerance, providing insight into potential specialized roles of At4g25040 .

What bioinformatic approaches are most effective for analyzing evolutionary relationships of At4g25040?

For evolutionary analysis of At4g25040, implement a comprehensive bioinformatic pipeline combining multiple sequence alignment, phylogenetic tree construction, and protein domain analysis. First, retrieve CASP-like protein sequences from diverse plant species including monocots and dicots. Perform multiple sequence alignments using MUSCLE or MAFFT algorithms, with manual curation of transmembrane regions. Construct phylogenetic trees using both Neighbor-Joining and Maximum Likelihood methods with appropriate substitution models and bootstrap validation (1000 replicates). From existing analyses of CASP family proteins, At4g25040 should be analyzed within the context of the six established subfamilies. Compare protein features including amino acid length, molecular weight, and isoelectric point across species, similar to the comparative analysis between AtCASPs (152-297 residues, 16-32 kDa, pI 4.2-10.22) and OsCASPs (153-421 residues, 16-20 kDa, pI 4.2-10.02). Additionally, examine synteny relationships to identify duplication events and evolutionary pressures.

How can I design experiments to resolve contradictory data about At4g25040 function?

To resolve contradictory data regarding At4g25040 function, implement a systematic experimental design that controls for genetic background, environmental variables, and methodological differences. First, generate multiple independent knockout and overexpression lines in the same genetic background to eliminate position effects or background mutations. Conduct experiments in controlled growth chambers with precisely defined conditions, as environmental factors significantly impact CASP-like protein function. Implement a blocking experimental design to reduce variability, improve statistical power, and detect subtle phenotypic differences. For example, when analyzing growth parameters, group plants by developmental stage and measure multiple metrics (root length, biomass, flowering time) to obtain comprehensive phenotypic data. Additionally, validate molecular tools (antibodies, expression constructs) in appropriate control experiments and use multiple methodological approaches to confirm key findings. This rigorous approach will help resolve inconsistencies, similar to how complementary results from AtCASPL4C1 knockout and overexpression studies provided strong evidence for its negative regulation of growth despite availability of only a single T-DNA insertion mutant .

What analytical methods can determine molecular interactions of At4g25040 with other cellular components?

To characterize molecular interactions of At4g25040, implement a multi-method approach combining in vivo and in vitro techniques. First, use co-immunoprecipitation with epitope-tagged At4g25040 expressed in Arabidopsis, followed by mass spectrometry to identify interacting proteins. Complement this with split-ubiquitin or membrane yeast two-hybrid assays specifically designed for membrane proteins. For lipid interactions, adapt analytical methods used for other membrane proteins such as the acyltransferase At4g24160, employing thin-layer chromatography (TLC) and electron spray ionization-mass spectrometry (ESI-MS) to detect potential lipid modification activities. Additionally, use fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to visualize protein-protein interactions in planta. To analyze membrane domain associations, implement membrane fractionation techniques followed by western blotting. This comprehensive approach will reveal At4g25040's interactome and provide mechanistic insights into its cellular functions .

How might At4g25040 be involved in crop improvement strategies for stress resilience?

Based on current understanding of CASP-like proteins, At4g25040 shows significant potential for crop improvement strategies focusing on stress resilience. The negative regulation of growth and cold tolerance observed in AtCASPL4C1 suggests that modulating At4g25040 expression could enhance stress adaptation. To explore this potential, implement CRISPR/Cas9 gene editing to create knockout or expression-modified variants in crop species with orthologous genes. Design field trials with appropriate blocking strategies to reduce experimental variability and enhance statistical power for detecting phenotypic differences. Evaluate multiple stress parameters including drought, salinity, and temperature extremes, while simultaneously measuring yield components. The presence of stress-responsive elements in the At4g25040 promoter (including abscisic acid and ethylene response elements) provides molecular targets for fine-tuning expression in response to specific environmental challenges. Development of crops with optimized nutrient uptake and stress resilience represents a promising application of At4g25040 research findings .

What experimental approaches can elucidate the role of At4g25040 in specialized membrane domain formation?

To investigate At4g25040's role in specialized membrane domain formation, implement an integrated cell biology approach combining advanced microscopy, biochemical analysis, and genetic manipulation. Generate fluorescent protein fusions (e.g., At4g25040-GFP) and analyze their distribution using super-resolution microscopy techniques such as structured illumination microscopy (SIM) or photoactivated localization microscopy (PALM) to visualize membrane microdomain formation with nanometer precision. Complement imaging with biochemical fractionation methods to isolate detergent-resistant membrane fractions and identify co-localizing proteins and lipids. Additionally, employ dynamic techniques such as fluorescence recovery after photobleaching (FRAP) to analyze the mobility of At4g25040 within membranes. Create chimeric proteins exchanging domains between At4g25040 and other CASP family members to identify regions responsible for specific localization patterns. This approach will provide mechanistic insights into how At4g25040 contributes to membrane organization, potentially revealing functions beyond the known roles of CASP proteins in Casparian strip formation, similar to the observation that AtCASPL4C1 functions extend beyond root endodermal barriers to broader roles in plant growth and development .

What are the primary challenges in working with recombinant At4g25040 protein and how can they be addressed?

The primary challenges in working with recombinant At4g25040 include maintaining protein stability, proper folding of transmembrane domains, and preserving functional activity. To address these issues, implement optimized storage protocols by aliquoting purified protein and storing at -20°C/-80°C to prevent freeze-thaw degradation. For functional studies, consider using partial protein constructs that exclude problematic transmembrane regions while retaining functional domains. When full-length protein is necessary, use specialized membrane-mimetic environments such as liposomes, nanodiscs, or detergent micelles to maintain proper folding. For activity assays, design experiments based on protocols validated for related proteins, such as the acyltransferase activity assays developed for At4g24160, which included two-dimensional thin-layer chromatography (TLC) and mass spectrometry analysis. Additionally, consider co-expression with potential interacting partners to enhance stability and activity. Implementing these strategies will maximize the utility of recombinant At4g25040 for structural and functional studies .

How can researchers effectively analyze contradictory phenotypic data from At4g25040 studies?

To effectively analyze contradictory phenotypic data from At4g25040 studies, implement a systematic meta-analysis approach combined with targeted validation experiments. First, compile all available phenotypic data with detailed documentation of experimental conditions, genetic backgrounds, and methodological approaches. Identify potential sources of variability such as growth conditions, developmental stages, or tissue-specific effects. Design validation experiments with improved statistical power by implementing blocking strategies that group similar experimental units together, thereby reducing variability within blocks and enhancing detection of treatment effects. For example, when analyzing growth parameters, ensure plants are grouped by developmental stage and genetic background. Additionally, expand phenotypic analysis beyond traditional metrics to include multiple parameters (e.g., root architecture, biomass, flowering time, stress responses) to build a comprehensive phenotypic profile. This approach will help reconcile seemingly contradictory results, similar to how research on AtCASPL4C1 revealed that while knockout plants showed no significant alterations in Casparian strip formation, they displayed marked differences in growth dynamics and stress responses, indicating context-dependent functions .

What statistical approaches are most appropriate for analyzing At4g25040 functional studies?

For At4g25040 functional studies, implement robust statistical approaches that account for experimental design complexities and biological variability. When comparing phenotypes between genotypes (wild-type, knockout, and overexpression lines), use mixed-effects models that incorporate both fixed effects (genotype, treatment) and random effects (biological replicates, blocks). This approach properly addresses the hierarchical nature of biological experiments and accounts for non-independence of observations. For time-course experiments studying expression patterns or developmental phenotypes, apply repeated measures ANOVA or longitudinal data analysis techniques. When analyzing multiple phenotypic parameters simultaneously, implement multivariate statistical methods such as principal component analysis (PCA) or MANOVA to identify patterns across variables. Ensure experimental design incorporates sufficient blocking to reduce variability and increase statistical power, particularly important when detecting subtle phenotypic differences often observed with membrane proteins like At4g25040. Always verify that data meet assumptions of statistical tests (normality, homoscedasticity) and use appropriate transformations or non-parametric alternatives when necessary .

How should researchers interpret At4g25040 expression data across different tissues and conditions?

To properly interpret At4g25040 expression data across tissues and conditions, implement a comprehensive analytical framework that integrates multiple data types. First, normalize expression data using appropriate reference genes validated for stability across the specific tissues and conditions being studied. For tissue-specific expression analysis, complement quantitative PCR data with promoter-reporter constructs (e.g., promoter-GUS) to visualize spatial expression patterns with cellular resolution. When analyzing stress responses, examine expression kinetics over multiple time points rather than single measurements, similar to how ClCASPL and AtCASPL4C1 showed peak expression at different time points after cold treatment (12h and 48h, respectively). Additionally, correlate expression patterns with phenotypic data to establish functional relevance. Consider evolutionary conservation by comparing expression profiles with orthologous genes in other species. Finally, integrate expression data with protein localization studies to determine if changes in transcript abundance correspond to altered protein distribution. This multifaceted approach will provide a more complete understanding of At4g25040 regulation and function across developmental contexts and environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.