Recombinant Arabidopsis thaliana CASP-like protein At5g40300 (At5g40300)

What is the structural characterization of CASP-like protein At5g40300?

Arabidopsis thaliana CASP-like protein At5g40300 (AtCASPL4A1) is a full-length protein consisting of 270 amino acid residues. The recombinant version often includes an N-terminal histidine tag for purification purposes. According to protein structure prediction analyses, it likely contains multiple transmembrane domains, similar to other CASP family proteins which typically feature four transmembrane domains . The protein is part of the CASP family (UPF0497) in Arabidopsis, which includes 39 genes organized into 6 distinct subfamilies based on their phylogenetic relationships . The amino acid sequence contains specific structural elements that contribute to its membrane localization and functional properties.

How does the expression pattern of AtCASPL4A1 compare to other CASP-like proteins?

While the search results don't specifically detail the expression pattern of AtCASPL4A1 (At5g40300), studies on the related AtCASPL4C1 (At3g55390) demonstrate that CASP-like proteins can have expression patterns beyond just the root endodermis where Casparian strips form. GUS reporter gene expression analysis for AtCASPL4C1 revealed widespread expression in various organs and vascular tissues, suggesting more fundamental roles in plant growth and development . By analogy, AtCASPL4A1 may also have expression patterns that extend beyond the classically studied root endodermis, which would support specialized functions in different plant tissues. Understanding the complete tissue-specific and stress-responsive expression patterns of AtCASPL4A1 would provide valuable insights into its biological functions beyond Casparian strip formation.

What are the optimal conditions for reconstitution of recombinant AtCASPL4A1?

For optimal reconstitution of lyophilized recombinant AtCASPL4A1 protein, researchers should follow these methodological steps:

• Briefly centrifuge the product vial prior to opening to bring the contents to the bottom of the tube.

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

• Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to enhance protein stability.

• Aliquot the reconstituted protein to minimize freeze-thaw cycles.

• Store working aliquots at 4°C for up to one week for immediate experimental use.

• For long-term storage, keep aliquots at -20°C or -80°C .

It's important to note that repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . The reconstituted protein is typically stored in a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose as a stabilizing agent .

What experimental approaches are used to study AtCASPL4A1 subcellular localization?

To determine the subcellular localization of CASP-like proteins such as AtCASPL4A1, researchers commonly employ fluorescence microscopy techniques using fusion proteins. Based on studies with related proteins:

• GFP-fusion protein expression: Creating translational fusions between AtCASPL4A1 and fluorescent proteins like GFP, either under native or constitutive promoters. Similar approaches with ClCASPL showed plasma membrane localization .

• Stable transgenic plant generation: Transforming Arabidopsis with constructs encoding the fluorescently tagged protein, preferably using the native promoter to maintain physiological expression levels. This approach has been successful for studying related proteins such as GFP-bZIP28 and GFP-bZIP60 .

• Transient expression systems: For preliminary localization studies, researchers may use protoplasts or Nicotiana benthamiana leaf infiltration to rapidly assess localization patterns.

• Co-localization studies: Using established subcellular markers to confirm precise membrane domain localization, particularly important for proteins like CASPs that may localize to specific membrane domains.

These experimental approaches provide insights into both the general subcellular localization of AtCASPL4A1 and its potential association with specific membrane domains or structures.

What evidence supports the role of CASP-like proteins in cold stress responses?

Research on CASP-like proteins has revealed significant connections to cold stress responses in plants. A cold-induced transcript encoding a CASP-like protein (ClCASPL) was identified in watermelon (Citrullus lanatus), and its ortholog in Arabidopsis (AtCASPL4C1) was found to play an important role in cold tolerance . Experimental evidence supporting this connection includes:

• Gene expression analysis: AtCASPL4C1 is cold-inducible, showing increased expression under low-temperature conditions .

• Phenotypic characterization of genetic variants: T-DNA knock-out plants of AtCASPL4C1 displayed elevated tolerance to cold stress, while plants overexpressing ClCASPL showed increased sensitivity to cold stress in Arabidopsis .

• Growth measurements under stress conditions: Absence of AtCASPL4C1 resulted in altered growth dynamics, with knock-out plants showing faster growth, increased biomass, and earlier flowering compared to wild-type plants and ClCASPL overexpressing plants .

These findings suggest that CASP-like proteins, including potentially AtCASPL4A1, may function as negative regulators of cold tolerance in plants, affecting growth and developmental responses to low-temperature stress. The mechanism appears to extend beyond their role in Casparian strip formation, pointing to more fundamental functions in plant stress physiology .

How do knock-out and overexpression approaches contribute to understanding AtCASPL4A1 function?

Knock-out and overexpression approaches provide complementary insights into protein function through gain-of-function and loss-of-function analyses. For studying CASP-like proteins such as AtCASPL4A1, these approaches have proven valuable:

• T-DNA insertion knock-out lines: Studies with AtCASPL4C1 knock-out plants revealed surprisingly positive phenotypic effects, including faster growth, increased biomass, and enhanced cold tolerance . Similar approaches with AtCASPL4A1 would help determine if it shares functional redundancy with other family members.

• Overexpression studies: Overexpression of the watermelon ClCASPL in Arabidopsis resulted in increased sensitivity to cold stress , demonstrating how gain-of-function approaches can reveal negative regulatory roles. For AtCASPL4A1, overexpression under constitutive promoters could similarly reveal whether it acts as a growth regulator.

• Complementation experiments: Expressing AtCASPL4A1 in knockout backgrounds of other CASP family members can determine functional redundancy and specificity within this gene family.

• Tissue-specific expression: Using tissue-specific promoters to express AtCASPL4A1 can help isolate its function in particular plant tissues or developmental stages.

When designing these experiments for AtCASPL4A1, researchers should consider the potential for functional redundancy within the CASP family and implement proper controls, including expression level verification and phenotypic characterization under various growth conditions and stresses.

What are the methodological considerations for studying protein-protein interactions involving AtCASPL4A1?

Investigating protein-protein interactions of membrane proteins like AtCASPL4A1 presents unique methodological challenges due to their hydrophobic nature and membrane localization. Researchers should consider these approaches:

• Yeast two-hybrid (Y2H) with modifications: Standard Y2H may not be optimal for transmembrane proteins like AtCASPL4A1. Split-ubiquitin Y2H systems are better suited for membrane protein interaction studies, allowing detection of interactions at the membrane.

• Co-immunoprecipitation (Co-IP): Using tagged versions of AtCASPL4A1 (such as the His-tagged recombinant protein) enables pull-down assays to identify interacting partners . For membrane proteins, specialized detergents that maintain protein structure while solubilizing membranes are essential.

• Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein interactions in living plant cells by fusing potential interacting proteins to complementary fragments of a fluorescent protein.

• Proximity-based labeling: Techniques like BioID or TurboID, where AtCASPL4A1 is fused to a biotin ligase that biotinylates nearby proteins, can identify the proximal proteome of membrane-localized proteins.

• Mass spectrometry analysis: Following co-IP or proximity labeling, mass spectrometry can identify interaction partners. For CASPs, which form membrane domains, this approach has been particularly informative in identifying components of the Casparian strip.

When designing these experiments, researchers should consider both constitutive interactions and condition-specific interactions (e.g., under cold stress) that might reveal functional mechanisms of AtCASPL4A1 in stress responses.

How can ChIP-seq and transcriptomic approaches be integrated to understand the regulatory networks involving AtCASPL4A1?

While AtCASPL4A1 itself is not a transcription factor, understanding its place in regulatory networks can benefit from integrated genomic approaches similar to those used for studying UPR-related transcription factors:

• Transcriptomic profiling: RNA-sequencing in wild-type versus AtCASPL4A1 knockout or overexpression lines can identify differentially expressed genes (DEGs) affected by AtCASPL4A1 function. This approach, as demonstrated in UPR studies, can reveal downstream effectors and biological pathways .

• Time-course experiments: Analyzing gene expression changes over time following stress treatment (e.g., cold stress) in different genetic backgrounds can reveal the temporal dynamics of AtCASPL4A1-mediated responses .

• Network modeling: Weighted gene co-expression network analysis (WGCNA) can identify modules of co-expressed genes associated with AtCASPL4A1 function, as demonstrated in the analysis of UPR transcription factor targets .

• Integration with transcription factor binding data: While AtCASPL4A1 is not a transcription factor, correlating its expression pattern with transcription factor ChIP-seq data can identify potential upstream regulators controlling its expression.

• Cis-regulatory element (CRE) analysis: Examining promoters of AtCASPL4A1-dependent genes for enriched motifs can identify transcription factors that might function downstream of AtCASPL4A1-mediated signaling .

This integrated approach has proven successful in identifying regulatory networks and functional modules in stress responses, as demonstrated in the analysis of ER stress response pathways .

What are the challenges and solutions in studying functional redundancy among CASP family proteins?

The CASP family in Arabidopsis consists of 39 genes , presenting significant challenges in studying functional redundancy. Based on research with CASP proteins:

• Challenge: Phenotypic masking in single mutants

  • Single mutants of CASP genes often show minimal phenotypic changes due to functional redundancy, as observed with Atcasp1 or Atcasp3 single mutants that displayed normal Casparian strip formation .

  • Solution: Generate and analyze higher-order mutants (double, triple, etc.) by crossing single T-DNA insertion lines or using CRISPR/Cas9 to target multiple family members simultaneously.

• Challenge: Tissue-specific and developmental roles

  • CASP proteins may have redundant functions in specific tissues or developmental stages only.

  • Solution: Employ tissue-specific promoters for complementation studies and analyze phenotypes across various developmental stages and stress conditions.

• Challenge: Partial functional overlap

  • Family members may share some but not all functions.

  • Solution: Perform domain-swapping experiments between family members to identify structural features responsible for specific functions.

• Challenge: Compensatory transcriptional responses

  • Knockout of one family member may lead to upregulation of others, as observed with increased transcript abundance of CASP1-5 in AtCASPL4C1 knockouts .

  • Solution: Monitor expression of all family members in various genetic backgrounds and use inducible silencing approaches to circumvent long-term compensatory mechanisms.

Understanding the extent of functional redundancy is critical for correctly interpreting phenotypic data from AtCASPL4A1 studies and placing this protein in the broader context of CASP family functions in plant development and stress responses.

What are the precise specifications of recombinant AtCASPL4A1 for experimental use?

Below is a comprehensive technical specification table for recombinant Arabidopsis thaliana CASP-like protein At5g40300:

This recombinant protein features the complete amino acid sequence: MEELEKTQKFQKKKKQQQEKQDQSSPINFEMSSRSSLHSLPQTTIESPPDSPTLSSIPDS HGSSPHTIIPTPSVAKTETPFRVTNGEEEKKVSESRRQLRPSFSSSSSTPRESKWASLIR KALLGFRVIAFVSCLVSFSVMVSDRDKGWAHDSFYNYKEFRFCLAANVIGFYSGFMICD LVYLLSTSIRRSRHNLRHFLEFGLDQMLAYLLASASTSASIRVDDWQSNWGADKFPDLAR ASVALSYVSFVAFAFCSLASGYALCALRSI .

What is the comparative analysis of gene expression changes in CASP family members under different experimental conditions?

Based on studies with related CASP family proteins, the following table summarizes gene expression changes observed under various experimental conditions:

This comparative expression analysis reveals important regulatory relationships among CASP family members. In AtCASPL4C1 knockout plants, the significant upregulation of CASP1-5 suggests potential compensatory mechanisms within the CASP family . These expression changes correlate with phenotypic observations, including altered growth dynamics and enhanced cold tolerance in knockout plants. Such expression profiles provide valuable insights into the molecular networks and functional redundancy of CASP family proteins, which can guide experimental approaches for studying AtCASPL4A1.

What are the emerging research directions for understanding the broader functions of CASP-like proteins beyond Casparian strip formation?

Research on CASP family proteins is rapidly expanding beyond their classical role in Casparian strip formation. Several promising research directions include:

• Membrane domain organization: CASP-like proteins may function more broadly in organizing specialized membrane domains in various cell types, similar to how they organize the Casparian strip domain. Investigating AtCASPL4A1's role in membrane subdomain formation in non-endodermal tissues represents a significant research opportunity .

• Stress signaling pathways: The demonstrated role of AtCASPL4C1 in cold tolerance suggests CASP-like proteins may function in environmental stress signaling cascades. Research exploring the role of AtCASPL4A1 in other abiotic stresses (drought, salt, heat) could reveal integrated stress response networks .

• Plant growth regulation: Knockout of AtCASPL4C1 resulted in faster growth and increased biomass, suggesting CASP-like proteins may negatively regulate growth. Understanding how AtCASPL4A1 impacts plant growth could have implications for crop improvement strategies .

• Vascular tissue development: The expression of AtCASPL4C1 in vascular tissues suggests functions beyond the endodermis. Investigating AtCASPL4A1's role in vascular development could provide insights into plant vasculature formation and function .

• Interaction with hormone signaling pathways: The growth phenotypes observed in CASPL mutants suggest potential crosstalk with plant hormone pathways. Studies exploring interactions between AtCASPL4A1 and hormone signaling could reveal regulatory mechanisms.

These research directions highlight the expanding significance of CASP-like proteins in plant biology and offer promising avenues for future investigation of AtCASPL4A1 function.

How might CRISPR/Cas9 genome editing advance functional studies of AtCASPL4A1?

CRISPR/Cas9 genome editing offers several advantages for functional studies of AtCASPL4A1 compared to traditional T-DNA insertion approaches:

• Precision editing: CRISPR/Cas9 allows for precise modifications at specific genomic locations, enabling targeted mutations within functional domains of AtCASPL4A1. This precision can help elucidate the role of specific protein regions, such as transmembrane domains or interaction sites.

• Multiplexed editing: Given the functional redundancy observed within the CASP family , simultaneously targeting multiple family members can overcome compensation effects. CRISPR multiplexing allows for creating double, triple, or higher-order mutants in a single transformation event.

• Allelic series generation: Using CRISPR/Cas9, researchers can generate various mutation types (null alleles, domain-specific mutations, regulatory element modifications) in AtCASPL4A1, creating an allelic series that provides nuanced insights into protein function.

• Tissue-specific editing: Combining CRISPR/Cas9 with tissue-specific promoters allows for studying AtCASPL4A1 function in specific tissues or developmental stages, helping to dissect its potentially diverse roles in different plant parts.

• Promoter editing: Modifying cis-regulatory elements in the AtCASPL4A1 promoter can help identify upstream regulators and stress-responsive elements controlling its expression.

These CRISPR-based approaches would significantly advance our understanding of AtCASPL4A1 function by providing more precise genetic tools than traditional methods, particularly important given the complex nature of CASP family functional redundancy and tissue-specific roles.