Recombinant Arabidopsis thaliana Casparian strip membrane protein 2 (CASP2)

Shipped with Ice Packs
In Stock

Description

Casparian Strip Formation

CASP2 plays a crucial role in the formation of Casparian strips, which are specialized cell wall modifications in the endodermis of plant roots . These strips form essential barriers that regulate the movement of water and solutes through the root system. CASP2, along with other CASP family proteins, mediates the deposition of lignin and other materials necessary for constructing these barrier structures .

Membrane Domain Organization

One of the most significant functions of CASP2 is the establishment of the Casparian strip membrane domain (CSD) . CASPs are initially targeted to the entire plasma membrane but are subsequently removed from lateral plasma membranes, remaining exclusively localized at the CSD . Within this domain, they demonstrate extremely low turnover rates, creating stable membrane scaffolds that serve as platforms for additional cellular processes .

Cell Wall Modification

Beyond structuring membrane domains, CASP2 directs modifications to the cell wall adjacent to its membrane domain . Through interactions with secreted peroxidases, CASP proteins mediate lignin deposition and Casparian strip formation . This dual functionality—establishing membrane scaffolds and directing cell wall modifications—can be functionally distinguished, as formation of the CASP domain occurs independently from lignin deposition .

CASP2 in the Context of Plant Evolution

The CASP family represents a significant evolutionary development in land plants. CASP-like (CASPL) proteins have been identified throughout the plant kingdom, from green algae to advanced land plants . Interestingly, analysis of plant genomes suggests that a CASP-specific signature emerged coincident with the evolution of Casparian strips, as this signature is absent in plants lacking Casparian strips . This correlation highlights the specialized role of CASP proteins in the evolutionary adaptation of plants to terrestrial environments.

Relationship to Other Protein Families

Phylogenetic analyses have revealed conservation between CASPLs and the MARVEL protein family found outside the plant kingdom . The conserved residues between these families are predominantly located in transmembrane domains, suggesting evolutionary preservation of core structural elements involved in membrane organization .

Antibody Development and Immunological Studies

Recombinant CASP2 serves as a valuable immunogen for developing antibodies against Arabidopsis thaliana CASP2. These antibodies can be employed in various applications, including enzyme-linked immunosorbent assay (ELISA) and Western blotting (WB) . The availability of specific antibodies (e.g., CSB-PA880237XA01DOA) enables researchers to study CASP2 expression and localization patterns in plant tissues .

Functional Studies of Membrane Domain Formation

The recombinant protein facilitates investigations into membrane domain formation and cell wall modification processes. By providing a purified form of CASP2, researchers can conduct in vitro studies on protein-protein interactions, particularly focusing on how CASP2 interacts with peroxidases and other enzymes involved in lignin deposition .

Comparative Studies with CASP-like Proteins

Recombinant CASP2 enables comparative analyses with other members of the CASP family and related CASP-like proteins . Such studies contribute to our understanding of functional specialization within this protein family and illuminate evolutionary relationships between different plant species.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific format requirements, please indicate them in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please let us know and we will prioritize its development.
Synonyms
CASP2; At3g11550; F24K9.22; Casparian strip membrane protein 2; AtCASP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Target Protein Sequence
MKNESTFIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLAIFDFLLRLAAIVAALA AAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPL ATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAV VSAFVSVVFFTILVVISGVALKRH
Uniprot No.

Target Background

Function
CASP2 (Casparian strip membrane protein 2) regulates membrane-cell wall junctions and localized cell wall deposition in *Arabidopsis thaliana*. It plays a critical role in the establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips. Casparian strips are a specialized cell wall modification of the root endodermis that act as an apoplastic barrier between the plant's internal apoplasm and the external apoplasm. This barrier prevents lateral diffusion of substances, ensuring controlled nutrient uptake and maintaining plant homeostasis.
Database Links

KEGG: ath:AT3G11550

STRING: 3702.AT3G11550.1

UniGene: At.43737

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Very restricted localization following a belt shape within the plasma membrane which coincides with the position of the Casparian strip membrane domain.

Q&A

What is CASP2 and how does it function in Arabidopsis thaliana?

CASP2 (Casparian strip membrane protein 2) is a critical integral membrane protein in Arabidopsis thaliana that belongs to the CASP family (UPF0497). It is one of five primary endodermis-specific CASPs (CASP1-5) that localize to the Casparian Strip Domain (CSD) and play essential roles in Casparian strip formation. CASP2, along with other CASPs, is responsible for enforcing displacement of initial secretory foci through exclusion of vesicle tethering factors, thereby ensuring rapid fusion of membrane domains .

The protein functions as part of a membrane scaffold that defines the precise location for Casparian strip formation, creating two essential features: protein exclusion zones and membrane-cell wall attachments. These features are critical for establishing the apoplastic diffusion barrier in plant roots. When combined with other CASPs, CASP2 contributes to the formation of a fully functional diffusion barrier that regulates water and nutrient uptake in plants .

How are CASPs involved in Casparian strip formation?

The Casparian strip is a specialized cell wall modification in the endodermis of plant roots that forms a paracellular diffusion barrier. CASPs play several crucial roles in its formation:

  • Domain establishment: CASPs create a specialized plasma membrane domain (CSD) that acts as a template for Casparian strip deposition. This domain is characterized by protein exclusion and tight membrane-wall attachment .

  • Secretory machinery coordination: CASPs enforce displacement of initial secretory foci through exclusion of vesicle tethering factors, ensuring proper fusion of membrane domains .

  • Scaffold formation: CASPs form a scaffold that recruits the lignin polymerization machinery to the exact position where the Casparian strip will form .

  • Membrane-wall attachment: CASPs facilitate strong adhesion between the plasma membrane and cell wall at the Casparian strip, creating a "band plasmolysis" pattern where the membrane remains attached to the cell wall even under plasmolytic conditions .

Studies using caspQ (quintuple mutant of CASP1-5) have demonstrated that in the absence of CASPs, the protein exclusion zone disappears completely, membrane-wall attachment is lost, and the typical band plasmolysis pattern is replaced by a more general plasmolysis resembling other cell types .

What are the conserved domains of CASP2 and their significance for protein function?

CASP2, like other members of the CASP family, contains several conserved domains that are crucial for its proper function:

  • Transmembrane domains: CASP2 contains four transmembrane (TM) domains (likely at positions similar to those predicted for other CASPs) that anchor the protein in the plasma membrane .

  • Extracellular loop 1 (EL1): Contains a highly conserved nine-amino acid signature (ESLPFFTQF) that is specific to endodermis-expressed CASPs. This sequence is crucial for endodermis-specific function and is conserved across species, suggesting its importance in CASP function .

  • Extracellular loop 2 (EL2): Contains several conserved residues that affect localization. While mutations in residues conserved only in the CASP subgroup do not affect localization, mutations in residues shared among most CASPLs can significantly impact protein targeting to the CSD .

  • C-terminal region: Important for protein-protein interactions and oligomerization with other CASP family members to form the CSD platform .

The conservation of these domains, particularly the nine-amino acid signature in EL1, suggests that they are essential for the proper targeting, localization, and function of CASP2 in Casparian strip formation .

How is CASP2 expression regulated in Arabidopsis?

CASP2 expression in Arabidopsis is highly regulated in a tissue-specific and developmental manner:

  • Endodermis-specific expression: CASP2 shows strong, endodermis-specific expression, similar to other primary CASPs (CASP1-5) .

  • Developmental regulation: Expression follows the developmental progression of endodermal differentiation and Casparian strip formation .

  • Transcriptional control: The MYB36 transcription factor appears to be a master regulator of the Casparian strip differentiation program. In myb36 mutants, the entire CS differentiation program is lacking, suggesting that MYB36 regulates CASP2 expression .

  • Coordinated regulation with other CASPs: When specific CASPs are mutated or knocked out, the expression of remaining CASPs can be altered. For instance, in AtCASPL4C1 knockout plants, the transcript abundance of CASP2, CASP3, CASP4, and CASP5 was significantly increased, suggesting compensatory regulation mechanisms .

  • Conserved regulatory elements: The regulatory elements controlling CASP expression appear to be conserved across species. For example, a 2-kb genomic fragment upstream of a Lotus japonicus CASP homolog was sufficient to drive endodermis-specific expression in Arabidopsis, suggesting conservation of regulatory mechanisms .

What experimental approaches are most effective for studying CASP2 function in vivo?

Several complementary approaches have proven effective for investigating CASP2 function in vivo:

  • Genetic approaches:

    • T-DNA insertion mutants: Isolating single or multiple T-DNA insertion alleles in CASP genes. For CASP2, exon-localized T-DNA insertions provide valuable functional insights .

    • CRISPR-Cas9 multiplexing: Particularly useful when creating higher-order mutants. This approach successfully generated a caspQ (quintuple) mutant by targeting multiple CASP genes simultaneously with two gRNAs per gene .

    • Complementation studies: Expressing wild-type or modified CASP2 in mutant backgrounds to test functional requirements of specific domains .

  • Imaging techniques:

    • Fluorescent protein fusions: Creating translational fusions (e.g., mCitrine-CASP2) to visualize protein localization at the CSD .

    • Co-localization studies: Using membrane markers like SYP122 together with Propidium Iodide to visualize the CSD and protein exclusion properties .

    • Plasmolysis experiments: Mounting seedlings in hyperosmotic solutions (e.g., 0.8M Mannitol) to observe membrane-wall attachments at the Casparian strip .

  • Functional assays:

    • Apoplastic barrier function tests: Measuring penetration of Propidium Iodide (PI) into the central vasculature to assess diffusion barrier integrity .

    • Protein-protein interaction studies: Using techniques like co-immunoprecipitation or yeast two-hybrid assays to identify interaction partners .

    • Electron microscopy: For ultrastructural analysis of plasma membrane-cell wall interactions in the CSD .

  • Expression systems:

    • Heterologous expression in E. coli: For recombinant protein production (as demonstrated with His-tagged CASP2) .

    • In planta expression: Using native or foreign promoters to drive expression in wild-type or mutant backgrounds .

These methodologies, especially when combined, provide comprehensive insights into CASP2 localization, dynamics, interactions, and function in vivo.

How do mutations in CASP2 affect Casparian strip formation and plant development?

The effects of CASP2 mutations must be considered in the context of functional redundancy with other CASPs. Research findings indicate:

  • Single mutant effects:

    • Individual CASP2 mutations show limited phenotypes due to functional redundancy with other CASPs (CASP1, CASP3, CASP4, CASP5) .

    • Specific point mutations in conserved residues can affect protein localization without completely abolishing function. For example, mutations in highly conserved residues in EL2 (across CASPLs) can cause mislocalization or delayed localization to the CSD .

  • Higher-order mutant effects:

    • In the caspQ quintuple mutant (including CASP2 mutation):

      • Complete absence of the protein exclusion zone normally visualized by complementary localization with PI .

      • Loss of membrane-wall attachment at the CS, resulting in abnormal plasmolysis patterns .

      • Formation of abnormal, lignin-rich foci instead of the continuous lignin ring of the normal Casparian strip .

      • Compromised apoplastic barrier function, as measured by PI penetration into the vasculature .

  • Developmental consequences:

    • While specific CASP2 mutation phenotypes aren't detailed in the search results, studies of CASPL family members (like AtCASPL4C1) show that mutations can affect primary root length, biomass accumulation, and flowering time .

    • The complete loss of CASP function severely impairs the apoplastic diffusion barrier, potentially affecting water and nutrient uptake, though plants can partially compensate through other mechanisms .

  • Diverse functional requirements:

    • The combined activity of at least three CASPs (which could include CASP2) is required to restore a fully functional Casparian strip in caspQ mutants .

    • Different CASPs show varying abilities to rescue the caspQ phenotype, suggesting functional diversification within the family .

Understanding CASP2 mutations requires considering both its unique functions and its cooperative roles with other CASP family members in establishing the Casparian strip.

What molecular mechanisms govern CASP2 interactions with other proteins at the Casparian strip domain?

The molecular interactions of CASP2 at the Casparian strip domain involve several sophisticated mechanisms:

  • CASP oligomerization:

    • CASP proteins, including CASP2, form homo- and hetero-oligomeric complexes at the plasma membrane. These complexes establish the foundation of the CSD platform .

    • The C-terminal regions and potentially the transmembrane domains facilitate these protein-protein interactions .

  • Exclusion of other membrane proteins:

    • CASPs establish an exclusion zone that prevents other membrane proteins (like SYP122) from entering the CSD. This exclusion mechanism is fundamental to CSD identity .

    • The mechanism likely involves local alterations in membrane fluidity or composition, creating a specialized membrane domain .

  • Vesicle tethering regulation:

    • CASPs enforce displacement of initial secretory foci by excluding vesicle tethering factors, which ensures proper membrane domain fusion .

    • This regulation of vesicle trafficking is critical for maintaining the discrete boundary of the CSD.

  • Cell wall interaction:

    • CASP2 and other CASPs mediate strong attachment between the plasma membrane and cell wall at the Casparian strip, evident from plasmolysis experiments where the membrane remains attached to the CS even under hyperosmotic conditions .

    • This attachment likely involves interactions with cell wall components or proteins that bridge the membrane-wall interface.

  • Lignin polymerization machinery recruitment:

    • The CASP platform serves as a scaffold that recruits enzymes involved in lignin polymerization, directing the precise deposition of lignin to form the Casparian strip .

    • This recruitment involves molecular interactions between CASPs and components of the lignin biosynthesis and polymerization machinery.

These interaction mechanisms collectively establish the CSD as a precisely localized, functionally specialized membrane domain essential for Casparian strip formation and function.

What are the optimal methods for expressing and purifying recombinant CASP2 for structural and functional studies?

Based on the search results, particularly from the commercial recombinant CASP2 product information , and general practices in membrane protein biochemistry, the following methods are recommended:

  • Expression systems:

    • E. coli expression: Successfully used for full-length Arabidopsis thaliana CASP2 with N-terminal His-tag .

    • Alternative systems: For more complex studies, consider eukaryotic expression systems like yeast, insect cells, or plant-based expression systems that may provide better folding environments for plant membrane proteins.

  • Construct design considerations:

    • Full-length vs. truncated: For CASP2, full-length expression (1-204 amino acids) has been demonstrated .

    • Fusion tags: N-terminal His-tag has been successfully used and is recommended for initial purification approaches .

    • Codon optimization: Consider optimizing codons for the expression host to improve yield.

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC): For His-tagged CASP2 .

    • Size exclusion chromatography (SEC): As a secondary purification step to achieve >90% purity.

    • Detergent selection: Critical for membrane protein solubilization; test multiple detergents (DDM, LMNG, etc.) for optimal activity retention.

  • Buffer considerations:

    • Tris/PBS-based buffers at pH 8.0 have been used successfully .

    • Addition of stabilizers: 6% trehalose has been used to stabilize the purified protein .

  • Storage recommendations:

    • Lyophilization: CASP2 has been successfully prepared as a lyophilized powder .

    • Reconstitution: Recommended in deionized sterile water to 0.1-1.0 mg/mL .

    • Cryoprotection: Addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

    • Aliquoting: Recommended to avoid repeated freeze-thaw cycles .

  • Quality control:

    • SDS-PAGE analysis: To confirm >90% purity .

    • Functional assays: To verify that the recombinant protein retains native-like activity.

    • Thermal stability tests: To assess protein folding and stability.

When moving to structural studies, consider screening multiple constructs with various tags and boundaries to identify the optimal construct for crystallization or cryo-EM studies.

What are the current contradictions or gaps in our understanding of CASP2 function?

Several important questions and contradictions remain unresolved regarding CASP2 function:

  • Functional specificity vs. redundancy:

    • While the search results indicate that CASPs show some degree of diversification in their nanodomain localization and ability to rescue the caspQ lignin deposition phenotype, the specific unique functions of CASP2 versus other CASPs remain poorly defined .

    • It's unclear why plants maintain five endodermis-expressed CASPs if they are largely redundant, suggesting undiscovered specific functions for each.

  • Molecular mechanism of domain formation:

    • The precise mechanism by which CASP2 contributes to the formation of the protein exclusion zone at the CSD is not fully understood .

    • How CASP2 mediates membrane-wall attachment at the molecular level remains to be elucidated.

  • Interaction partners:

    • While CASPs interact with each other, the complete interactome of CASP2, including potential interactions with other proteins involved in Casparian strip formation, is not comprehensively characterized in the search results.

    • The search results mention metacaspase 2 (MC2) in Arabidopsis, but any potential functional relationships between CASP2 and MC2 are not addressed .

  • Regulation mechanisms:

    • The search results indicate that in AtCASPL4C1 knockouts, transcript abundance of CASP2 (along with CASP3, CASP4, and CASP5) is significantly increased , but the mechanism of this regulation and its physiological significance are not explained.

    • The specific transcription factors and signaling pathways that regulate CASP2 expression under different environmental conditions remain to be fully characterized.

  • Evolutionary origin and diversification:

    • While CASP homologs with the conserved nine-amino acid signature are absent in more primitive plants like Physcomitrella patens and Selaginella moellendorffii , the evolutionary trajectory of CASP2 specialization in higher plants is not well documented.

  • Structure-function relationships:

    • The specific structural determinants of CASP2 that dictate its localization and function are not fully resolved, though some conserved residues in EL2 have been shown to affect localization .

Addressing these gaps would significantly advance our understanding of CASP2's role in Casparian strip formation and potentially reveal new functions in plant development and stress responses.

How does CASP2 compare functionally and structurally to other CASP family members?

CASP2 belongs to a diverse family of 39 CASP and CASP-LIKE (CASPL) proteins in Arabidopsis, with both shared and distinct characteristics:

This comparative analysis reveals both functional overlap and specialization within the CASP family, with CASP2 playing a specific role in the collaborative formation of the Casparian strip.

What methodological challenges exist in studying CASP2 localization and dynamics?

Investigating CASP2 localization and dynamics presents several significant methodological challenges:

Addressing these challenges requires combining multiple complementary techniques and developing new methodologies specifically tailored to study membrane proteins at specialized domains like the CSD.

How do environmental stresses influence CASP2 expression and function?

While the search results don't directly address the effects of environmental stresses on CASP2 specifically, we can infer potential relationships based on the information provided and general knowledge of Casparian strip function:

  • Potential stress influences:

    • The Casparian strip serves as a critical barrier controlling water and nutrient uptake in roots . Environmental stresses that affect water relations (drought, salinity) or nutrient availability might therefore influence CASP2 expression and function.

    • Since CASP2 is essential for proper Casparian strip formation , stresses that require adjustment of root barrier properties may modulate CASP2 expression or localization.

  • Related CASPL stress responses:

    • The search results indicate that CASPL proteins (related to CASPs) can influence stress responses. For instance, AtCASPL4C1 knockout mutants displayed faster growth, more biomass, and earlier flowering compared to wild type , suggesting that some CASPL family members may regulate growth responses that could be relevant under stress conditions.

    • Overexpression of ClCASPL (from watermelon) in Arabidopsis significantly decreased primary root length , indicating that CASP-related proteins can influence root development, which is often modified in response to stress.

  • Regulatory relationships:

    • The transcript abundance of CASP2 (along with CASP3, CASP4, and CASP5) was significantly increased in AtCASPL4C1 knockouts , suggesting a regulatory relationship that could potentially be influenced by stress conditions.

    • MYB36 appears to be a master regulator of the Casparian strip differentiation program, including CASP expression . Environmental stresses could potentially modulate this regulatory pathway.

  • Research approaches to address this question:

    • Expression analysis: Quantitative RT-PCR or RNA-seq to measure CASP2 expression under various stress conditions (drought, salt, nutrient deficiency, etc.).

    • Promoter analysis: Examining the CASP2 promoter for stress-responsive elements.

    • Phenotypic analysis: Comparing wild-type and CASP mutant responses to environmental stresses.

    • Localization studies: Investigating whether stress conditions alter CASP2 localization or the integrity of the Casparian strip.

    • Physiological measurements: Assessing whether stresses affect the barrier function of the Casparian strip in wild-type vs. CASP mutant plants.

Understanding how environmental stresses influence CASP2 expression and function represents an important research direction that could reveal new insights into how plants adapt their root barrier properties in response to changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.