Recombinant Arabidopsis thaliana Casparian strip membrane protein 4 (CASP4)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CASP4 belongs to the CASPARIAN STRIP MEMBRANE DOMAIN PROTEIN (CASP) family, which mediates the formation of lignin-based Casparian strips in plant root endodermis . These transmembrane scaffolds create diffusion barriers that regulate ion and water transport. The recombinant form of CASP4 retains its structural and functional properties for experimental studies.

Recombinant Production and Purification

Recombinant CASP4 is synthesized in E. coli and purified under denaturing conditions :

  • Purity: >90% (SDS-PAGE) .

  • Storage: Lyophilized powder or Tris-based buffer with 50% glycerol at -20°C/-80°C .

  • Reconstitution: Solubilized in sterile water or glycerol-containing buffers to maintain stability .

Stability Considerations:

  • Repeated freeze-thaw cycles degrade the protein .

  • Working aliquots stored at 4°C remain stable for one week .

Role in Casparian Strip Formation:

  • CASP4 collaborates with CASP1–5 to form membrane domains that recruit lignin polymerization machinery, creating apoplastic barriers .

  • These domains restrict lateral diffusion of plasma membrane proteins and lipids, ensuring polarized nutrient transport .

Applications in Plant Biology:

  1. Barrier Function Studies: Used to dissect mechanisms of ion selectivity and hydraulic regulation in roots .

  2. Stress Response Research: CASP homologs (e.g., CASPL4C1) influence cold tolerance and growth dynamics , suggesting CASP4 may have analogous roles.

  3. Protein Interaction Mapping: His-tagged CASP4 facilitates pull-down assays to identify binding partners involved in cell wall modification .

Comparative Analysis of CASP Family Proteins

ProteinFunctionExpression PatternMutant Phenotype
CASP4Scaffolds Casparian strip formationRoot endodermisNot explicitly reported
CASPL4C1Regulates cold tolerance and growthVascular tissues, ubiquitousFaster growth, altered flowering

Research Limitations and Future Directions

  • Functional Redundancy: CASP4’s role may overlap with other CASP proteins, complicating phenotype analysis .

  • Structural Studies: The protein’s transmembrane topology remains poorly resolved, necessitating cryo-EM or NMR studies .

  • Stress Signaling: Links between CASP4 and abiotic stress pathways are underexplored compared to CASPLs .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CASP4; At5g06200; MBL20.8; Casparian strip membrane protein 4; AtCASP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Target Protein Sequence
MKSDSIAVDVPAESSSVIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAA ATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVRPLAV APRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVS AFASVTFLAILVVISGVSLKRP
Uniprot No.

Target Background

Function
CASP4 regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips. Casparian strips are cell wall modifications of the root endodermis that create an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Gene References Into Functions
  1. S-RBP11 is a chloroplast protein involved in responses to salt and oxidative stresses. PMID: 24413693
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Very restricted localization following a belt shape within the plasma membrane which coincides with the position of the Casparian strip membrane domain.

Q&A

What is the CASP family in Arabidopsis thaliana and how is CASP4 classified within this family?

The CASP (Casparian strip membrane domain protein) family in Arabidopsis thaliana comprises 39 genes defined as part of the UPF0497 family. Within this family, CASP1/2/3/4/5 have been specifically identified as proteins associated with Casparian strip formation in the endodermis. These proteins are organized into six subfamilies based on phylogenetic analysis, with CASP4 belonging to the group directly involved in Casparian strip membrane domain (CSD) formation . The CASP family proteins are among the earliest known proteins responsible for the CSD formation, playing a crucial role in establishing this specialized membrane domain.

What is the biological function of CASP4 and related proteins in Arabidopsis thaliana?

CASP4, along with other members of the CASP family (CASP1/2/3/5), plays a fundamental role in the formation of the Casparian strip in the root endodermis of Arabidopsis thaliana. The Casparian strip forms a crucial diffusion barrier in the root that controls the selective uptake of water and nutrients. In Arabidopsis, the Casparian strip is primarily composed of a lignin polymer without suberin . The CASPs function as membrane scaffold proteins that define the precise location for Casparian strip formation and recruit the lignin polymerization machinery to this site. While single mutations in CASP genes (such as CASP1 or CASP3) may not dramatically alter Casparian strip formation due to functional redundancy, combined mutations (such as casp1/casp3 double mutants) result in disorganized Casparian strip development .

How do CASP-like proteins differ from canonical CASP proteins in Arabidopsis?

CASP-like (CASPL) proteins share structural similarities with canonical CASP proteins but may have divergent functions. For example, AtCASPL4C1 (At3g55390), which is orthologous to ClCASPL from watermelon, contains four transmembrane domains similar to canonical CASPs but appears to have functions beyond Casparian strip formation . While canonical CASPs (CASP1-5) are primarily involved in Casparian strip formation in the root endodermis, CASPL proteins can be expressed in various tissues and may play roles in other biological processes, such as cold stress responses. The localization of CASPLs at membrane domains suggests they may mediate membrane subdomain formation in various cell types beyond the endodermis .

What are the recommended methods for expressing and purifying recombinant Arabidopsis thaliana CASP4?

For successful expression and purification of recombinant Arabidopsis thaliana CASP4, researchers typically employ several expression systems based on the experimental requirements. E. coli-based expression systems are commonly used for basic structural studies, while baculovirus and mammalian cell systems are preferred when post-translational modifications are essential . When working with CASP4, which contains multiple transmembrane domains, membrane protein expression protocols should be followed, often using detergent solubilization methods.

The general purification workflow includes:

  • Selection of an appropriate expression system (E. coli, yeast, baculovirus, or mammalian cells)

  • Addition of affinity tags (His, GST, or biotin) to facilitate purification

  • Optimization of induction conditions to maximize protein expression

  • Membrane solubilization using appropriate detergents

  • Affinity chromatography followed by size exclusion chromatography

  • Validation of protein purity and activity

Available commercial sources offer recombinant CASP proteins with various tags and expression systems that can serve as useful controls for experimental validation .

What antibodies are currently available for studying CASP4 in Arabidopsis thaliana and what applications are they validated for?

Based on the available data, there are specific antibodies available for detecting CASP4 in Arabidopsis thaliana. These antibodies have been validated for multiple applications, making them suitable for diverse experimental approaches:

CodeProduct NameSpecies ReactivityApplication
CSB-PA866914XA01DOACASP4 AntibodyArabidopsis thalianaELISA, WB (ensure identification of antigen)

This antibody has been specifically validated for Enzyme-Linked Immunosorbent Assay (ELISA) and Western Blot (WB) applications with the recommendation to ensure proper identification of the target antigen . When designing experiments involving immunodetection of CASP proteins, researchers should consider the potential cross-reactivity between closely related family members and may need to validate specificity through appropriate controls, such as using tissues from knockout mutants.

What experimental design is recommended for studying CASP4 knockout/knockdown effects in Arabidopsis thaliana?

For investigating the functional significance of CASP4 in Arabidopsis thaliana, a comprehensive experimental design should include:

Research has demonstrated that single mutants of CASP genes may not show dramatic phenotypes due to functional redundancy. For instance, Atcasp1 or Atcasp3 single mutants displayed unaltered Casparian strip formation compared to wild-type plants, while casp1/casp3 double mutants exhibited disorganized Casparian strips . Therefore, generating higher-order mutants (double, triple, or quadruple) may be necessary to observe clear phenotypic effects.

How does the expression pattern of CASP4 correlate with environmental stress responses in Arabidopsis?

While direct information about CASP4's specific response to environmental stresses is limited in the provided search results, insights can be gained from studies on related CASP-like proteins. Research on AtCASPL4C1, a member of the CASP family, has shown that it is cold-inducible and plays a role in cold tolerance . Analysis using a β-glucuronidase (GUS) reporter revealed that AtCASPL4C1 is widely expressed in various organs and its expression increases under cold conditions. Interestingly, knockout of AtCASPL4C1 resulted in elevated tolerance to cold stress, while overexpression of the orthologous ClCASPL from watermelon increased sensitivity to cold stress in Arabidopsis .

This suggests a potential regulatory role for CASP family proteins in environmental stress responses beyond their structural function in Casparian strip formation. When studying CASP4's role in stress responses, researchers should consider:

  • Transcriptional profiling under various stress conditions (cold, drought, salt, heat)

  • Comparing stress responses between wild-type and casp4 mutant plants

  • Investigating potential crosstalk between CASP4 and known stress signaling pathways

  • Examining whether CASP4 expression or localization changes during stress adaptation

What is the current understanding of the interaction network between CASP4 and other proteins involved in Casparian strip formation?

The formation of the Casparian strip requires a complex interaction network of multiple proteins. While the provided search results don't detail specific CASP4 protein-protein interactions, understanding the general CASP interaction network provides valuable insights.

CASP proteins function as membrane scaffold proteins that:

  • Define the precise location for Casparian strip formation

  • Recruit lignin polymerization machinery to this site

  • Interact with other proteins to coordinate the assembly of the Casparian strip diffusion barrier

The functional redundancy observed among CASP family members (where single mutants show minimal phenotypes while higher-order mutants display more severe defects) suggests overlapping interaction networks . Advanced research on CASP4 should consider:

  • Proteomics approaches to identify CASP4-specific interacting partners

  • Comparative analysis of interactomes between different CASP proteins

  • Investigation of whether specific CASP4 domains mediate distinct protein interactions

  • Determination of how environmental conditions might modify these interaction networks

How do genomic variations in CASP4 affect its function across different Arabidopsis accessions?

Genetic variation between different Arabidopsis accessions can significantly impact gene function and phenotypic expression. Although the search results don't provide specific information about CASP4 variations across accessions, they do highlight an important example of genomic structural variation in Arabidopsis that affects genetic studies:

The heterochromatic knob (hk4S) on chromosome 4 represents a major chromosomal inversion that differs between commonly used Arabidopsis accessions. Col-0 and approximately 170 other accessions carry this inversion, while Ler-1 and certain other accessions do not . This structural variation prevents crossovers within the inverted region when accessions with and without the inversion are crossed.

Researchers studying CASP4 variations across accessions should:

  • Examine sequence polymorphisms in CASP4 across diverse Arabidopsis accessions

  • Consider the genomic context of CASP4 and whether it might be affected by large-scale structural variations

  • Assess whether CASP4 functional differences correlate with natural variation in Casparian strip properties

  • Use CRISPR/Cas9 genome editing to introduce specific variants for functional validation

Recent advances in chromosome engineering, such as the targeted reversal of the hk4S inversion using egg-cell specific Cas9 expression, demonstrate the feasibility of manipulating large genomic regions to study their impact on gene function and recombination .

What are the latest approaches for visualizing CASP4 localization and dynamics in living plant tissues?

Advanced imaging techniques for studying CASP proteins including CASP4 involve:

  • Fluorescent protein fusions: GFP-tagging of CASP4 has been successfully used to demonstrate plasma membrane localization, as demonstrated with related proteins like ClCASPL-GFP . When designing such constructs, researchers should consider:

    • N- versus C-terminal tagging effects on protein function

    • Use of flexible linkers to minimize interference with protein folding

    • Expression under native promoters to maintain physiological expression levels

  • Super-resolution microscopy techniques:

    • Structured Illumination Microscopy (SIM) for improved resolution of membrane domains

    • Stimulated Emission Depletion (STED) microscopy for nanoscale visualization

    • Single-molecule localization microscopy for tracking protein dynamics

  • Live-cell imaging approaches:

    • Photoconvertible fluorescent proteins to track protein movement

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Fluorescence Correlation Spectroscopy (FCS) for quantifying diffusion rates

These techniques can provide crucial insights into how CASP4 assembles into the Casparian strip domain and how this process is regulated during development and in response to environmental signals.

How can CRISPR/Cas9 genome editing be optimized for studying CASP4 function in Arabidopsis thaliana?

CRISPR/Cas9 technology offers powerful approaches for investigating CASP4 function through precise genome modifications. Based on the search results, which describe successful application of CRISPR/Cas9 for chromosomal engineering in Arabidopsis , the following strategies can be adapted for CASP4 research:

  • Selection of appropriate Cas9 variants:

    • Staphylococcus aureus Cas9 (SaCas9) has been successfully used in Arabidopsis and may offer advantages for certain applications

    • High-fidelity Cas9 variants can minimize off-target effects

  • Tissue-specific expression strategies:

    • Egg cell-specific promoters (EC1.1/EC1.2) have shown efficacy for germline modifications

    • Root endodermis-specific promoters may be particularly relevant for CASP4 studies

  • Guide RNA design considerations:

    • Targeting intergenic regions adjacent to CASP4 for large structural modifications

    • Multiple guide RNAs for creating precise deletions or replacements

    • Ensuring protospacer sequences are specific to avoid off-target editing

  • Screening and validation approaches:

    • PCR-based genotyping for identifying successful editing events

    • Sequencing to confirm precise modifications

    • Phenotypic characterization to assess functional consequences

These strategies can be employed for various CASP4-focused applications, including:

  • Creating knockout mutations to study loss-of-function phenotypes

  • Introducing specific amino acid changes to analyze domain functions

  • Adding reporter tags for visualizing protein localization

  • Modifying regulatory regions to alter expression patterns

What computational approaches are useful for predicting functional domains and post-translational modifications in CASP4?

For comprehensive computational analysis of CASP4 structure and function, researchers should consider the following approaches:

  • Transmembrane domain prediction:

    • Multiple TM prediction programs have successfully identified four transmembrane domains in CASP-like proteins

    • These domains (approximately amino acids 45-67, 87-109, 130-149, and 169-191 in related proteins) are critical for membrane integration

  • Functional domain annotation:

    • Identification of conserved motifs across the CASP family

    • Structural modeling based on any available crystal structures

    • Molecular dynamics simulations to predict protein behavior in membranes

  • Post-translational modification prediction:

    • Phosphorylation sites that might regulate protein activity

    • Glycosylation patterns that could affect protein stability

    • Ubiquitination sites that might control protein turnover

  • Evolutionary analysis:

    • Phylogenetic comparisons across the 39 members of the CASP family in Arabidopsis

    • Cross-species conservation analysis to identify functionally critical residues

    • Selection pressure analysis to identify rapidly evolving regions

These computational approaches should be integrated with experimental validation to develop a comprehensive understanding of CASP4 structure-function relationships. The four transmembrane domain structure identified in related CASP proteins provides a starting point for more detailed structural and functional analyses of CASP4 .

How can knowledge about CASP4 contribute to improving plant stress tolerance in crop species?

Understanding CASP4 and related proteins' functions in Arabidopsis can inform strategies for enhancing stress tolerance in crops through several approaches:

  • Translating findings from model to crop systems:

    • Identifying orthologs of CASP4 in major crop species

    • Characterizing their roles in forming root barriers

    • Determining whether similar cold-response mechanisms exist as observed with AtCASPL4C1

  • Genetic modification strategies:

    • Modulating CASP4 ortholog expression to potentially enhance stress tolerance

    • Creating targeted mutations based on functional domains identified in Arabidopsis

    • Engineering improved Casparian strips for enhanced nutrient and water use efficiency

  • Phenotypic implications for crop improvement:

    • Altered growth dynamics (AtCASPL4C1 knockout plants showed faster growth and increased biomass)

    • Modified flowering time (earlier flowering was observed in AtCASPL4C1 knockouts)

    • Enhanced cold tolerance (knockout plants displayed elevated tolerance to cold stress)

The observation that manipulation of certain CASP-like genes affects both development and stress tolerance suggests that carefully targeted modifications of CASP4 orthologs in crops could potentially yield varieties with improved agronomic traits.

What are the comparative aspects of CASP4 function across different plant species?

Comparative analysis of CASP proteins across plant species reveals both conserved and divergent features:

  • Evolutionary conservation:

    • CASP family proteins are broadly conserved across plant species

    • The search results indicate available reagents for studying CASP4 orthologs in multiple species including Arabidopsis thaliana, Citrullus lanatus (watermelon), and others

  • Functional differences:

    • ClCASPL in watermelon and its ortholog AtCASPL4C1 in Arabidopsis are both cold-inducible but may have distinct roles

    • Expression patterns may vary across species (AtCASPL4C1 is widely expressed in various organs)

  • Structural features:

    • Four transmembrane domains appear to be a conserved feature across CASP family proteins

    • Domain organization is likely maintained across species despite sequence variations

This comparative perspective is valuable for translating basic research findings from Arabidopsis to crop species and for understanding the evolution of Casparian strip formation across the plant kingdom.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.