Recombinant Arabidopsis thaliana Casparian strip membrane protein 5 (CASP5)

Shipped with Ice Packs
In Stock

Description

Functional Roles of CASP5

CASP5 regulates apoplastic barrier formation by:

  1. Scaffold Formation: Creating diffusion barriers in endodermal membranes to block lateral movement of ions and molecules .

  2. Cell Wall Modification: Recruiting peroxidases for lignin polymerization, reinforcing Casparian strips .

  3. Stress Adaptation: Indirect evidence suggests CASP-like proteins influence cold tolerance and growth dynamics (e.g., AtCASPL4C1) .

Recombinant Production in Arabidopsis

Arabidopsis-based super-expression systems offer advantages for producing complex proteins like CASP5 :

ParameterDetails
Expression VectorModified pEAQ-HT plasmids with strong promoters (e.g., CaMV 35S)
YieldUp to 0.4 mg/g fresh weight (FW) for model proteins (e.g., mCherry)
PurificationAffinity chromatography (His-tag); >85% purity via SDS-PAGE
AdvantagesNative post-translational modifications; compatibility with multi-subunit complexes

Key Steps:

  • Cloning: CASP5 cDNA ligated into expression vectors under tissue-specific promoters.

  • Transformation: Agrobacterium-mediated stable transformation or transient expression .

  • Localization: Confirmed via GFP fusion assays (e.g., plasma membrane targeting) .

Interaction Partners and Functional Networks

STRING-db analysis reveals CASP5’s interactome :

Interaction PartnerFunction
CASP4Collaborates in CSD formation and lignin deposition
GSO1Receptor kinase regulating CASP localization and Casparian strip integrity
MSL4/MSL6Mechanosensitive ion channels; potential crosstalk with CASP-mediated membrane stability

Challenges and Future Directions

  1. Expression Hurdles: Membrane proteins like CASP5 require optimized vectors and growth conditions to maintain stability .

  2. Functional Validation: Limited studies on recombinant CASP5 necessitate CRISPR/Cas9 knockouts or overexpression lines to confirm roles beyond root development .

  3. Biotechnological Applications: Potential uses include engineering stress-tolerant crops or synthetic biology scaffolds for nutrient sequestration.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion.
Synonyms
CASP5; At5g15290; F8M21_180; Casparian strip membrane protein 5; AtCASP5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Target Protein Sequence
MKSGQAEIMETSKGIQKSGLMSRRIAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQF IRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKRKTQNTRILLIILDVAMLGL LTSGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISGSLIGSFIAIVLLILLILLSA IALSRRH
Uniprot No.

Target Background

Function
CASP5 regulates membrane-cell wall junctions and localized cell wall deposition. It is crucial for the establishment of the Casparian strip membrane domain (CSD) and subsequent formation of Casparian strips, a cell wall modification of the root endodermis. These strips act as an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Database Links

KEGG: ath:AT5G15290

STRING: 3702.AT5G15290.1

UniGene: At.31822

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Very restricted localization following a belt shape within the plasma membrane which coincides with the position of the Casparian strip membrane domain.

Q&A

What is the role of CASP5 in Arabidopsis thaliana's Casparian strip formation?

CASP5 belongs to the Casparian strip membrane domain protein family that localizes specifically at Casparian strip formation sites in the endodermis. These proteins function as a scaffold to guide local lignin deposition by recruiting essential enzymes like Respiratory Burst Oxidase Homolog F (RBOHF), Peroxidase 64 (PER64), and Enhanced Suberin 1 (ESB1). This protein complex is critical for creating the apoplastic diffusion barrier that forces solutes through the symplastic pathway, controlling selective nutrient uptake into the vasculature . The precise spatial localization of CASP proteins is regulated by receptor-like kinases SCHENGEN1 (SGN1) and SGN3, ensuring the integrity of the Casparian strip.

How is CASP5 expression regulated in Arabidopsis thaliana?

CASP5 expression is primarily regulated by the MYB36 transcription factor, which serves as a master regulator for multiple Casparian strip components. MYB36 itself is regulated by SCARECROW (SCR), which is a direct target of SHORT-ROOT (SHR). SHR is expressed in the stele and moves to the endodermal cell via the symplastic pathway, creating a precise spatial pattern for downstream gene expression . This regulatory cascade ensures that CASP proteins are exclusively expressed in endodermal cells directly contacting the stele, resulting in the precisely positioned Casparian strip formation.

What are the evolutionary relationships of CASP genes across plant species?

Phylogenetic analysis indicates that CASP genes are highly conserved across land plant species. The mechanism for Casparian strip formation appears to be evolutionarily maintained, with evidence showing similar expression patterns when Arabidopsis promoters are introduced into other species such as tomato and soybean. GUS staining experiments demonstrated that ATCASP1pro drives similar expression patterns in the endodermal cells of soybean and tomato hairy roots as observed in Arabidopsis . This conservation suggests that CASP5 and other CASP family members likely play similar roles across diverse plant lineages, having evolved together with vascular tissues to provide protective barriers.

What are the recommended methods for analyzing CASP5 protein localization in Arabidopsis roots?

For effective visualization of CASP5 localization:

  • Generate translational fusion constructs with fluorescent proteins (e.g., CASP5-GFP) under the control of native promoters

  • Transform Arabidopsis using Agrobacterium-mediated floral dip method

  • Select transgenic lines and grow seedlings for 5-7 days on vertical plates

  • Mount roots in propidium iodide (10 μg/ml) to counterstain cell walls

  • Examine using confocal laser scanning microscopy with appropriate filters

  • For co-localization studies, combine with endodermal markers or other CASP family proteins

The localization pattern should reveal CASP5 protein at the precise Casparian strip domain, forming a belt-like structure around endodermal cells. For temporal analysis, examine roots approximately 14 cells above the onset of the elongation zone where Casparian strips typically form in Arabidopsis .

How can researchers produce and purify recombinant CASP5 protein for functional studies?

For producing recombinant CASP5:

  • Clone the full-length CASP5 coding sequence into an appropriate expression vector (e.g., pET series) with a His-tag

  • Transform into E. coli expression hosts (BL21(DE3) or similar strains)

  • Induce protein expression with IPTG (0.5-1.0 mM) at 16-20°C for 16-20 hours

  • Lyse cells in buffer containing 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% sarkosyl, 10% glycerol

  • Purify using Ni-NTA affinity chromatography

  • Assess purity using SDS-PAGE (>80% purity is desirable)

  • Determine protein concentration using microplate BCA method

  • Store at -80°C to maintain stability

For working with membrane proteins like CASP5, addition of mild detergents may be necessary to maintain solubility. Filter the protein before use in cell culture applications to ensure sterility, though some protein loss may occur during filtration .

What CRISPR-Cas9 strategies are effective for generating CASP5 knockout lines in Arabidopsis?

For CRISPR-Cas9 editing of CASP5:

  • Design dual sgRNAs targeting exonic regions of CASP5 to create large deletions

  • Utilize the Staphylococcus aureus Cas9 (SaCas9) system with egg-cell-specific promoters for improved germline editing efficiency

  • Clone sgRNAs into a T-DNA vector containing SaCas9 under an egg-cell-specific promoter

  • Transform Arabidopsis via Agrobacterium-mediated floral dip

  • Select transgenic plants using appropriate markers

  • Screen T1 plants using PCR and sequencing to identify mutations

  • Propagate to T2 generation for homozygous mutant identification

This approach has been shown to achieve high-efficiency germline editing in Arabidopsis, allowing for the generation of stable knockout lines . When targeting CASP5, consider potential redundancy with other CASP family members and design experimental approaches to address compensatory effects.

How can researchers investigate the protein-protein interaction network of CASP5 in establishing the Casparian strip domain?

To elucidate CASP5 interaction networks:

  • In vivo proximity labeling approaches:

    • Generate BioID or TurboID fusions with CASP5

    • Express in Arabidopsis under native promoters

    • Identify interacting proteins via streptavidin pulldown followed by mass spectrometry

  • Split-ubiquitin yeast two-hybrid system (suitable for membrane proteins):

    • Use CASP5 as bait against cDNA libraries or candidate interactors

    • Screen for positive interactions on selective media

    • Validate interactions via co-immunoprecipitation

  • In planta FRET-FLIM analysis:

    • Generate fluorescent protein fusions with CASP5 and candidate interactors

    • Express in Arabidopsis and analyze energy transfer using confocal microscopy

    • Calculate interaction distances and strengths

Expected interaction partners include CASP family proteins (CASP1-4), lignin biosynthesis enzymes (PER64), oxidases (RBOHF), and receptor-like kinases (SGN1, SGN3) . This approach would reveal the temporal assembly of the CASP scaffold and how it coordinates enzyme recruitment.

What approaches can be used to study the role of CASP5 in stress responses and nutrient uptake regulation?

For investigating CASP5 in stress and nutrient regulation:

  • Conditional expression systems:

    • Generate lines with inducible CASP5 expression or CASP5 dominant-negative versions

    • Subject plants to various stresses (drought, salinity, nutrient deficiency)

    • Analyze physiological parameters (growth, ion content, hydraulic conductivity)

  • Radiotracer and fluorescent tracer studies:

    • Apply radiolabeled nutrients (⁴⁵Ca²⁺, ³²P) to wild-type and casp5 mutant roots

    • Measure uptake and translocation rates

    • Use propidium iodide penetration assays to assess Casparian strip integrity

  • Transcriptome and metabolome profiling:

    • Compare gene expression and metabolite profiles in wild-type vs. casp5 mutants

    • Focus on differentially expressed genes related to stress responses

    • Identify metabolic pathways affected by CASP5 dysfunction

The hydrophobic nature of Casparian strips makes them critical protective structures against environmental stresses . Research has shown that Casparian strip defects can alter responses to drought, salinity, and nutrient availability, suggesting CASP5 may be an important target for improving crop resilience.

How does CASP5 function coordinate with other endodermal differentiation processes?

To study CASP5 in the context of endodermal differentiation:

  • Time-course expression analysis:

    • Use RNA-seq or qRT-PCR at different developmental stages

    • Compare expression timing of CASP5 with suberin biosynthesis genes

    • Correlate with anatomical development using microscopy

  • Dual reporter systems:

    • Generate lines expressing different fluorescent proteins driven by promoters of CASP5 and other endodermal differentiation markers

    • Visualize the spatial and temporal progression of different differentiation programs

    • Quantify expression patterns using image analysis software

  • Genetic interaction studies:

    • Create double and triple mutants between casp5 and other endodermal development genes

    • Assess phenotypic enhancement or suppression

    • Map epistatic relationships in the differentiation pathway

This integrated approach would reveal how CASP5-mediated Casparian strip formation coordinates with other aspects of endodermal differentiation, such as suberin deposition, which typically occurs later in development and provides an additional diffusion barrier in the root endodermis.

How can researchers address potential redundancy between CASP family members in functional studies?

To overcome CASP redundancy challenges:

  • Higher-order mutant generation:

    • Create multiple combinations of casp mutants using CRISPR-Cas9 multiplex editing

    • Target conserved domains across multiple CASP genes

    • Screen using lignin staining (e.g., basic fuchsin) to identify Casparian strip defects

  • Artificial microRNA approach:

    • Design amiRNAs targeting conserved regions of multiple CASP transcripts

    • Express under tissue-specific or inducible promoters

    • Validate knockdown efficiency through qRT-PCR for all CASP genes

  • Dominant negative strategies:

    • Generate truncated CASP5 versions lacking functional domains

    • Express under native promoters to disrupt CASP complex formation

    • Monitor effects on Casparian strip integrity

When analyzing data from these approaches, consider that:

  • Partial functional compensation may obscure phenotypes

  • Phenotypic differences may only appear under specific stress conditions

  • Complete loss of CASP function may result in lethality

What methods are most effective for quantifying changes in Casparian strip integrity in CASP5 mutants?

For quantitative assessment of Casparian strip integrity:

  • Apoplastic tracer penetration assays:

    • Apply propidium iodide (10 μg/ml) to roots

    • Image using confocal microscopy

    • Quantify penetration distance using standardized measurements

    • Calculate percentage of "broken" Casparian strips per unit length

  • Electrical conductivity measurements:

    • Use microelectrodes to measure transepithelial electrical resistance

    • Compare wild-type vs. mutant values

    • Correlate with developmental stages and stress conditions

  • Inductively coupled plasma mass spectrometry (ICP-MS):

    • Analyze elemental composition of shoots from plants grown under controlled conditions

    • Compare mineral profiles between wild-type and casp5 mutants

    • Look for changes in elements that would normally be controlled by selective uptake

Data analysis should include:

  • Normalization to developmental stage (measured as distance from root tip)

  • Statistical comparison across multiple biological replicates

  • Correlation analysis between Casparian strip integrity and physiological parameters

What are the potential artifacts and pitfalls when analyzing CASP5 expression and localization data?

Common issues and solutions for CASP5 research:

  • Expression artifacts:

    • Problem: Overexpression using 35S promoters can cause mislocalization and artificial interaction patterns

    • Solution: Always use native promoters or endogenous tagging approaches

    • Analysis: Compare expression levels to endogenous CASP5 using qRT-PCR

  • Localization challenges:

    • Problem: Standard clearing methods may not be suitable for thicker roots

    • Solution: For species other than Arabidopsis, optimize tissue sectioning and imaging protocols

    • Analysis: Use cross-sections for clear visualization of Casparian strips in different species

  • Protein stability issues:

    • Problem: Recombinant CASP5 may aggregate during purification

    • Solution: Include stabilizing agents (glycerol, mild detergents) in buffers

    • Analysis: Verify protein integrity using size-exclusion chromatography before functional assays

  • Developmental timing variations:

    • Problem: CASP5 expression and Casparian strip formation vary with growth conditions

    • Solution: Standardize growth conditions and developmental staging

    • Analysis: Always report distance from root tip rather than absolute age when comparing expression data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.