Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB1 (CBSCBSPB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
CBSCBSPB1; At5g63490; MLE2.12; CBS domain-containing protein CBSCBSPB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CBSCBSPB1
Target Protein Sequence
MASQGGPRRSLSVTTASLHGKKKSMDMAERGLDTGRRSLTVSRSPLGLTGGERTVKRLRL SKALTVPATTTIYEACKRMASRRVDALLLTDSNEMLCGILTDKDIATRVISQELNVEETP VSKVMTKNPMFVLSETLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMER AAEKGKAIAAAVEGVEKSWGTNTSVPNTFIETLRDRMFRPSLSTIIPDDTKVLKVSPTDT VLTVAKKMVEFQSSCAVVIIEDKLRGIFTSKDILMRVVAENLPPSETLVETVMTQNPEST IVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGNEATNT MMQKFWDSAMALSPNEDDEDSRSESSMKVASEAETGKSFPFANTFSFKIEDKKHRKHRFI SDTRSLTEVITAIIQRVGDDIDPDNFPQILYEDEDHDKVLLASDSDLQAAIEHAKSIGWK SLRLHLDDSREGKGRRRRRASGSAESMEYVETDAWAAAYSGVAAGAALVAGLGFMAFLRK FGH
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G63490

STRING: 3702.AT5G63490.1

UniGene: At.49212

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of CBSCBSPB1 and how does it differ from other CBS domain-containing proteins in Arabidopsis thaliana?

CBSCBSPB1 belongs to a distinctive subgroup of CBS domain-containing proteins (CDCPs) characterized by the presence of two to four CBS domains coupled with a Phox and Bem1p (PB1) domain. The protein typically contains four CBS structural domains arranged in pairs, along with the PB1 domain, and may include a transmembrane domain. This structure distinguishes it from other CDCPs such as CBSX proteins (containing a single CBS pair) or CBSCLC proteins (containing CBS domains with voltage chloride channels) .

The CBS domains in CBSCBSPB1 likely form intramolecular dimeric structures (CBS pairs) as revealed by crystallographic studies of CBS domains. These domains are arranged in anti-parallel (head-to-tail) formations, similar to CBSX1 and CBSX2, which have been better characterized structurally . The PB1 domain is known to facilitate protein-protein interactions in signaling pathways, suggesting CBSCBSPB1 may participate in protein complexes or signaling cascades .

What are the proposed functions of CBSCBSPB1 in Arabidopsis thaliana?

Based on studies of other CBS domain-containing proteins in plants, CBSCBSPB1 likely functions as a metabolic sensor and regulatory protein involved in:

  • Redox homeostasis: Similar to other CDCPs, CBSCBSPB1 may participate in regulating cellular redox states, potentially interacting with thioredoxin systems .

  • Stress response signaling: The presence of the PB1 domain suggests involvement in signaling pathways related to environmental stresses. Promoter analysis of CDCP genes reveals enrichment in stress-responsive cis-regulatory elements, including those responding to anaerobic conditions, temperature stress, and hormone-mediated pathways .

  • Development regulation: CBSCBSPB proteins likely participate in plant growth and developmental processes, potentially through interaction with energy-sensing pathways .

  • Energy sensing: The CBS domains can potentially bind adenosine-containing ligands (ATP, AMP, or S-adenosylmethionine), suggesting a role in sensing cellular energy status and coordinating metabolic responses .

Unlike CBSX1 and CBSX2 that are localized to chloroplasts or CBSX3 found in mitochondria, CBSCBSPB1's subcellular localization may determine its specific cellular functions and interaction partners .

What are the optimal expression systems for producing recombinant CBSCBSPB1 protein?

For successful expression of functional recombinant CBSCBSPB1, consider the following systems and methodologies:

A. Arabidopsis-based super-expression system
The homologous Arabidopsis-based expression platform offers significant advantages for CBSCBSPB1 production:

  • Native post-translational modifications: The protein undergoes authentic modifications and can associate with endogenous interaction partners to form functional complexes .

  • Implementation approach:

    • Use Agrobacterium-mediated floral transformation with a strong promoter (e.g., 35S promoter)

    • Select the rdr6-11 background to minimize gene silencing

    • Establish petri dish-based cell cultures from transformed lines

    • Harvest typically 20-30g of material for laboratory-scale experiments

B. Alternative expression systems
For structural studies or when specific modifications are not critical:

  • Bacterial expression systems: Use E. coli with appropriate fusion tags (His-tag, GST) for simpler purification

  • Yeast expression: Consider when proper folding of CBS domains is critical but plant-specific modifications are not required

Comparative expression yields:

Expression SystemTypical YieldAdvantagesLimitations
Arabidopsis super-expression0.4 mg/g fresh weightAuthentic PTMs, native protein complexesTime-consuming transformation
E. coli5-20 mg/L cultureRapid, cost-effectiveLack of PTMs, potential misfolding
Yeast1-5 mg/L cultureEukaryotic processingDifferent glycosylation patterns

What purification strategy is most effective for isolating recombinant CBSCBSPB1 while maintaining its functional properties?

A systematic purification approach for CBSCBSPB1:

  • Initial extraction:

    • Use a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors

    • Include 1-5 mM ATP/AMP in the buffer to stabilize CBS domain interactions, as these domains bind adenosine-containing ligands

  • Affinity chromatography:

    • Utilize N-terminal or C-terminal affinity tags (His-tag or Strep-tag II) positioned to not interfere with the PB1 domain

    • Consider TEV protease cleavage sites for tag removal

  • Ion exchange chromatography:

    • Apply anion exchange (Q-Sepharose) at neutral pH based on the predicted isoelectric point

  • Size exclusion chromatography:

    • Use Superdex 200 to isolate properly folded protein and assess oligomeric state

    • Include adenosine-containing ligands in the buffer to maintain native conformation

  • Quality assessment:

    • Verify structural integrity using circular dichroism and thermal shift assays

    • Test functionality through binding assays with potential interaction partners, particularly thioredoxins

Critical considerations for maintaining functionality:

  • Avoid reducing agents that might disrupt potential regulatory disulfide bonds

  • Consider the presence of adenosine-containing ligands throughout purification to maintain CBS domain conformation

  • Test functionality through interaction assays with potential protein partners

How can researchers effectively characterize CBSCBSPB1 interaction with the thioredoxin system?

Based on studies of other CBS domain-containing proteins like CBSX1/2, the following methodological approach is recommended to characterize CBSCBSPB1 interactions with the thioredoxin system:

Step 1: In vitro interaction screening

  • Pull-down assays: Use purified recombinant CBSCBSPB1 as bait to identify potential thioredoxin partners from Arabidopsis extracts

  • Yeast two-hybrid screening: As performed for CBSX1, which identified interactions with several thioredoxins

Step 2: Verification of direct interactions

  • In vitro pull-down assays with recombinant proteins: Similar to those performed for CBSX2, which confirmed direct interaction with TRXm1 and TRXm2

  • Bimolecular Fluorescence Complementation (BiFC): To confirm interactions in planta

  • Surface Plasmon Resonance (SPR): To determine binding kinetics and affinity constants

Step 3: Functional assays

  • Thioredoxin activity assays: Test the effect of CBSCBSPB1 on thioredoxin activity:

    • Standard insulin reduction assay: Measure disulfide reduction in the presence/absence of CBSCBSPB1

    • Target-specific activity assays: Test activation of NADP-malate dehydrogenase or 2-Cys peroxiredoxin reduction

  • Ligand modulation testing: Examine how adenosine-containing ligands affect CBSCBSPB1-thioredoxin interactions:

    • Perform activity assays with varying concentrations of AMP, ADP, and ATP

    • Compare EC50 values to determine preferential ligand binding

Step 4: Structural studies

  • Co-crystallization: Attempt to obtain crystal structures of CBSCBSPB1 in complex with thioredoxins

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map interaction interfaces

What experimental approaches can determine the specific ligands that bind to the CBS domains of CBSCBSPB1?

To identify and characterize specific ligands binding to CBSCBSPB1's CBS domains:

Thermal shift assays (Differential Scanning Fluorimetry)

  • Incubate purified CBSCBSPB1 with potential ligands (ATP, ADP, AMP, S-adenosylmethionine)

  • Measure changes in protein melting temperature (Tm) using a fluorescent dye

  • Significant Tm shifts indicate ligand binding and stabilization

Isothermal Titration Calorimetry (ITC)

  • Directly measure thermodynamic parameters of ligand binding

  • Determine binding affinity (Kd), stoichiometry, and thermodynamic profiles (ΔH, ΔS)

  • Compare binding parameters across different adenylate ligands

Structural approaches

  • Co-crystallize CBSCBSPB1 with potential ligands for X-ray crystallography

  • Use NMR spectroscopy for solution-state binding studies

  • Apply cryo-EM to visualize larger complexes with bound ligands

Biochemical validation

  • Perform binding competition assays with radiolabeled ligands

  • Create site-directed mutants of key residues in the CBS domains to disrupt ligand binding

  • Compare binding properties with well-characterized CBS domains like those in CBSX1/2

Expected ligand binding properties based on related proteins:

LigandExpected KdEffect on Protein Function
ATP10-100 μMLikely strongest regulation effect, as observed with CBSX2
AMP50-500 μMModerate regulation, demonstrated to modulate CBSX activity
ADP30-300 μMIntermediate regulation effect
S-adenosylmethionine100-1000 μMPotential allosteric regulation

What strategies should be employed to generate and analyze CBSCBSPB1 knockout or overexpression lines in Arabidopsis?

Generation of genetic resources:

For knockout/knockdown lines:

  • T-DNA insertion lines: Screen existing collections (SALK, SAIL, GABI) for insertions in the CBSCBSPB1 gene

  • CRISPR-Cas9 gene editing:

    • Design sgRNAs targeting conserved regions of CBS domains

    • Use Agrobacterium-mediated transformation with CRISPR constructs

    • Screen transformants by sequencing to identify indels that disrupt the reading frame

For overexpression lines:

  • Promoter selection:

    • Constitutive (35S CaMV) for ubiquitous expression

    • Tissue-specific promoters for targeted expression

    • Inducible promoters (estrogen, ethanol, or dexamethasone-inducible) for temporal control

  • Fusion proteins:

    • C-terminal fluorescent protein tags for localization studies

    • Epitope tags for biochemical purification

For complementation studies:

  • Transform knockout lines with the wild-type CBSCBSPB1 gene under native promoter

  • Create point mutations in conserved residues of CBS domains to disrupt ligand binding

Phenotypic characterization approaches:

  • Development and growth analysis:

    • Monitor growth under standard and stress conditions (as performed with cbsx1 cbsx2 double mutants)

    • Measure parameters like rosette size, stem height, flowering time, and seed yield

    • Test low temperature response, as CBS genes show increased expression at low temperatures

  • Stress responses:

    • Expose plants to various abiotic stressors (drought, salt, heat, cold)

    • Analyze ROS levels using DAB and NBT staining

    • Measure stress marker gene expression

  • Redox homeostasis:

    • Measure H2O2 levels in different tissues and under stress conditions

    • Analyze activity of redox-regulated enzymes (NADP-MDH, PRXs)

    • Profile thioredoxin activity in mutant backgrounds

  • Molecular phenotyping:

    • Transcriptome analysis (RNA-seq) to identify affected pathways

    • Metabolite profiling to detect changes in adenylate levels and redox-related metabolites

    • Protein-protein interaction studies using co-immunoprecipitation followed by mass spectrometry

What phenotypes might be expected in CBSCBSPB1 mutant plants based on studies of other CBS domain proteins?

Based on research with other CBS domain-containing proteins, CBSCBSPB1 mutants may exhibit the following phenotypes:

1. Growth and development phenotypes:

  • Altered plant size and morphology, similar to the reduced rosette size observed in cbsx1 cbsx2 double mutants at low temperatures

  • Potential defects in chlorophyll content and photosynthetic efficiency, as seen in cbsx1 cbsx2 mutants

  • Possible reproductive abnormalities, as CBSX1 overexpression caused anther indehiscence through altered H2O2 levels

2. Stress response phenotypes:

  • Enhanced or diminished tolerance to abiotic stresses, particularly:

    • Cold stress (CBSX genes show increased expression at low temperatures)

    • Drought stress (CBS domains respond to energy status changes during stress)

    • Oxidative stress (due to altered redox homeostasis)

3. Metabolic alterations:

  • Changes in cellular redox state and thioredoxin activity

  • Alterations in energy homeostasis and adenylate ratios

  • Modified activity of redox-regulated enzymes in metabolic pathways

4. Biochemical changes:

  • Altered thioredoxin activation patterns

  • Changes in H2O2 levels in specific tissues

  • Modified lignin content in cell walls, as observed with CBSX1 manipulation

Comparative table of expected phenotypes based on other CBS protein studies:

Phenotypic CategoryRelated CBS Protein ObservationsExpected CBSCBSPB1 Phenotypes
Growthcbsx1 cbsx2 shows reduced growth at 12°C Possible growth defects, especially under stress
Photosynthesiscbsx1 cbsx2 has reduced chlorophyll at low temperatures Potential photosynthetic alterations
Stress toleranceCBSCBSPBs contain stress-responsive promoter elements Likely altered abiotic stress responses
Redox biologyCBSX proteins regulate thioredoxin systems Changes in cellular redox homeostasis
ReproductionCBSX1/2 overexpression causes sterility Possible reproductive abnormalities

How can structural studies of CBSCBSPB1 contribute to understanding its regulatory mechanisms in plant stress responses?

Advanced structural studies of CBSCBSPB1 can provide critical insights into its molecular mechanisms through the following approaches:

X-ray crystallography

  • Determine the 3D structure of CBSCBSPB1 in different states:

    • Apo-form (ligand-free)

    • With bound adenylate ligands (ATP, ADP, AMP)

    • In complex with interaction partners (thioredoxins)

  • Analyze the conformational changes induced by ligand binding, as has been done for CBSX1 and CBSX2

  • Map the relative orientations of the CBS domains and PB1 domain to understand their cooperative function

Solution NMR studies

  • Characterize dynamic regions and conformational changes upon ligand binding

  • Study the interaction interfaces with partner proteins like thioredoxins

  • Identify allosteric communication pathways between domains

Cryo-electron microscopy

  • Visualize larger complexes involving CBSCBSPB1 and its interaction partners

  • Determine how CBSCBSPB1 might function in multi-protein signaling complexes

  • Study conformational heterogeneity related to different functional states

Structural comparative analysis

  • Compare the CBSCBSPB1 structure with CBSX1/2 structures to understand functional specialization

  • Analyze differences in ligand binding pockets that might explain different adenylate preferences

  • Examine the unique structural features contributed by the PB1 domain

Insights expected from structural studies:

  • Ligand-induced conformational changes: Understand how adenylate binding alters CBSCBSPB1 structure and function, similar to ATP/AMP effects on CBSX2-thioredoxin interactions

  • Regulatory mechanisms: Identify how energy status (ATP/AMP ratio) might modulate CBSCBSPB1 activity during stress responses

  • Interaction specificity: Determine structural features that dictate specificity for particular thioredoxin isoforms or other partners

  • Evolution of CBS domain specialization: Compare with structures from different organisms to understand evolutionary adaptation of CBS domain functions

What is the relationship between CBSCBSPB1 and the plant energy sensing network during abiotic stress responses?

CBSCBSPB1 likely functions as an energy-sensing component within plant stress response networks. Based on knowledge of CBS domains and stress signaling, the following relationships can be proposed:

Energy sensing mechanisms:

  • CBS domains in CBSCBSPB1 likely bind adenylate ligands (ATP, ADP, AMP) whose cellular ratios reflect energy status

  • This binding probably modulates CBSCBSPB1's activity toward target proteins such as thioredoxins

  • During stress conditions, when cellular energy levels fluctuate, these changes could adjust CBSCBSPB1 regulatory functions

Integration with energy signaling pathways:

  • Potential cross-talk with SnRK1 (plant ortholog of AMPK) signaling, as some CBS domain-containing proteins function as γ-subunits in AMPK complexes

  • Possible connections to Target of Rapamycin (TOR) signaling, which regulates growth in response to energy and nutrient availability

  • Involvement in sugar signaling networks, particularly under stress conditions that affect carbohydrate metabolism

Coordination with redox networks:

  • Modulation of thioredoxin activities based on cellular energy status, as observed with CBSX2

  • Potential indirect regulation of Calvin cycle enzymes and photosynthetic electron transport components

  • Fine-tuning of ROS homeostasis in response to energy fluctuations during stress

Experimental approaches to investigate these relationships:

  • Metabolite profiling:

    • Measure adenylate ratios (ATP/AMP) in wild-type vs. CBSCBSPB1 mutants under various stresses

    • Analyze changes in carbohydrate metabolism during stress responses

  • Protein interaction studies:

    • Identify interactions between CBSCBSPB1 and energy-sensing kinases (SnRK1 complex components)

    • Perform proteomics of CBSCBSPB1 complexes isolated from plants under different energy states

  • Phosphoproteomics:

    • Analyze changes in protein phosphorylation patterns in CBSCBSPB1 mutants

    • Identify potential regulatory phosphorylation sites on CBSCBSPB1 itself

  • Transcriptomics and functional genomics:

    • Compare transcriptional responses to energy deprivation between wild-type and CBSCBSPB1 mutants

    • Analyze genetic interactions between CBSCBSPB1 and known energy-sensing pathway components

How might CBSCBSPB1 function be exploited to improve crop stress resilience in agricultural applications?

Leveraging knowledge of CBSCBSPB1's role in redox and energy sensing could lead to novel approaches for enhancing crop stress tolerance:

Genetic engineering strategies:

  • Modulated expression:

    • Fine-tuned overexpression of CBSCBSPB1 in specific tissues or under stress-inducible promoters

    • CRISPR-based promoter editing to optimize expression patterns

    • Creation of engineered CBSCBSPB1 variants with enhanced or specialized functions

  • Rational protein engineering:

    • Modification of adenylate binding pockets to alter ligand sensitivity

    • Engineering of the PB1 domain to enhance specific protein interactions

    • Creation of chimeric proteins combining CBSCBSPB1 domains with other regulatory components

Expected improvements in stress resilience:

  • Cold stress tolerance:

    • CBSX genes show enhanced expression at low temperatures

    • Engineering CBSCBSPB1 expression could potentially improve cold adaptation, similar to complementing the defects seen in cbsx1 cbsx2 double mutants

  • Drought and osmotic stress management:

    • Optimization of energy utilization during water limitation

    • Enhanced ROS scavenging through improved thioredoxin system regulation

  • Heat stress adaptation:

    • Maintenance of redox homeostasis during temperature fluctuations

    • Protection of photosynthetic machinery through regulated energy allocation

Experimental validation approaches:

  • Controlled environment testing:

    • Evaluate transgenic crops with modified CBSCBSPB1 under defined stress conditions

    • Measure physiological parameters (photosynthetic efficiency, ROS levels, metabolite profiles)

  • Field trials:

    • Assess yield stability across multiple environments

    • Evaluate responses to naturally occurring stress combinations

  • Systems biology assessment:

    • Integrate transcriptomic, metabolomic, and phenomic data to understand whole-plant effects

    • Model energy allocation and redox homeostasis under stress conditions

How does the evolutionary diversification of CBS domain proteins across plant species relate to environmental adaptation?

The evolution of CBS domain-containing proteins like CBSCBSPB1 likely reflects adaptation to diverse environmental challenges:

Evolutionary patterns across plant lineages:

  • The CBS domain family has undergone significant expansion in plants compared to other organisms, with 34 members in Arabidopsis, 59 in rice, and 66 in wheat

  • This expansion suggests functional diversification and specialization for plant-specific processes

  • The combination of CBS domains with different functional domains (PB1, CLC, SIS, etc.) indicates evolutionary innovation in regulatory mechanisms

Comparative analysis of CBSCBSPB proteins:

  • CBSCBSPB genes show varying conservation patterns across species, with differences in gene structure and motif arrangements

  • These variations likely reflect adaptation to different environmental conditions

  • Some species show expansion or contraction of specific CBS domain subfamilies, suggesting environmental specialization

Methodological approaches for evolutionary studies:

  • Phylogenomic analysis:

    • Construct comprehensive phylogenetic trees of CBS domain proteins across plant species

    • Identify patterns of gene duplication, loss, and neofunctionalization

    • Correlate evolutionary events with major environmental transitions in plant evolution

  • Protein structure comparison:

    • Compare binding pocket structures across species to identify adaptive changes

    • Analyze selection pressure on different protein domains

    • Identify lineage-specific structural adaptations

  • Functional conservation testing:

    • Perform cross-species complementation experiments

    • Test whether orthologs from stress-adapted species confer enhanced resilience

    • Identify critical residues that differ between orthologs from contrasting environments

  • Ecological correlation:

    • Analyze CBS gene family composition across plant species from diverse habitats

    • Correlate gene family expansions with specific environmental challenges

    • Study natural variation in CBSCBSPB1 orthologs in ecotypes adapted to different conditions

  • Ancestral sequence reconstruction:

    • Infer ancestral CBS domain sequences at key evolutionary nodes

    • Recreate and characterize ancestral proteins to understand functional evolution

    • Identify critical mutations that accompanied environmental adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.