Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2 (CBSCBSPB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CBSCBSPB2; At2g36500; F1O11.13; CBS domain-containing protein CBSCBSPB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CBSCBSPB2
Target Protein Sequence
MTTTPTSSGRRSISSIRRTSSASKKPVLQSEESESGSGSINENTSKPDSPLAQPVSDGER TVKKLRLSKALTINEGTTVFDACRRMAARRVDAVLLTDSSALLSGIVTDKDIATRVIAEG LRPEHTLVSKVMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIALLDITKCLYD AISRMEKAAEQGSALATAVEERHWGSGNFAFIDTLRERMFKPALSTIVTENTKVALVSAS DPVFVASKKMRDLRVNSVIIAVGNKIHGILTSKDILMRVVAQNLSPELTLVEKVMTPNPE CASIETTILDALHIMHDGKFLHLPVFDKDGFAVACLDVLQITHAAISTVENNSSGAVNDM ANTMMQKFWDSALALEPPEDYETHSDMSAMLINSEGKQSCPSQGLVSSFAFKFEDRKGRV QRFNSTGESFEELMSVVMQRCEADSGLQIMYQDDEGDKVLISRDSDLVAAVTFARSLGQK VLRLHLDFTETIAPLETIADLSEGNGGCVWWQTGVLAGAIVLTSIGLFVYLKRSKK
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G36500

STRING: 3702.AT2G36500.1

UniGene: At.37545

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the CBSCBSPB2 protein and what is its role in Arabidopsis thaliana?

CBSCBSPB2 (also referenced as Q9SJQ5) is a CBS domain-containing protein found in Arabidopsis thaliana. CBS domains play regulatory roles for many enzymes and help maintain intracellular redox balance in plants. While the specific function of CBSCBSPB2 is still being investigated, CBS domain-containing proteins in Arabidopsis are involved in multiple cellular processes including stress responses and energy sensing. The protein contains a defined amino acid sequence starting with MTTTPTSSGRRSISSIRRT and belongs to a larger family of CBS domain-containing proteins that are critical for plant metabolism and stress adaptation .

How do CBS domains generally function in plant proteins?

CBS domains typically function as regulatory modules rather than having direct catalytic activities. In plants like Arabidopsis thaliana, CBS domains act as cellular energy sensors by detecting changes in metabolites such as adenosine derivatives. When these domains bind to their target molecules, they induce conformational changes in the protein structure that can alter enzymatic activity. In some proteins, CBS domains form autoinhibitory regions that regulate protein function through binding-induced conformational changes . Additionally, CBS domains help maintain redox balance within plant cells and contribute to various stress response mechanisms, making them important for plant adaptation to environmental challenges .

What is the genomic context of CBSCBSPB2 in the Arabidopsis genome?

CBSCBSPB2 is encoded within the Arabidopsis thaliana genome, which has a total size of approximately 135 Mb distributed across five chromosomes. The current reference genome assembly is TAIR10, with annotation based on the Araport11 gene annotation released in 2016. The Araport11 annotation integrated data from 113 public RNA-seq datasets along with contributions from various research institutions . Within this annotated genome, CBSCBSPB2 is one of 34 identified CBS domain-containing proteins in Arabidopsis, belonging to a specific subgroup based on its domain architecture and sequence characteristics .

What are the optimal conditions for storing and handling recombinant CBSCBSPB2 protein?

For optimal preservation of recombinant CBSCBSPB2 protein activity, store the lyophilized protein at -20°C to -80°C upon receipt. For reconstitution, briefly centrifuge the vial to bring contents to the bottom and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add 50% glycerol (final concentration) and aliquot before storing at -20°C/-80°C to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week . The protein is typically provided in a Tris-based buffer with optimized pH and glycerol concentration. Repeated freeze-thaw cycles significantly diminish protein activity and should be avoided .

What expression systems are most effective for producing recombinant CBSCBSPB2?

E. coli expression systems are effectively used for producing recombinant Arabidopsis thaliana CBS domain-containing proteins, including CBSCBSPB2. For optimal expression, the protein is typically fused to an N-terminal His tag to facilitate purification . When designing expression constructs, it's important to maintain the complete amino acid sequence (as identified in search results) to preserve the structural integrity of the CBS domains. The expression protocol should be optimized for temperature, induction conditions, and duration to maximize protein yield while maintaining proper folding. After expression, purification typically involves affinity chromatography using the His tag, followed by quality control assessments including SDS-PAGE to confirm purity (greater than 90% is typically desirable) .

How can I verify the structural integrity of purified recombinant CBSCBSPB2?

To verify the structural integrity of purified recombinant CBSCBSPB2, employ a multi-method approach: First, conduct SDS-PAGE analysis to confirm the expected molecular weight and assess purity (aim for >90%). Second, perform western blotting using antibodies specific to the protein or its tag. Third, utilize circular dichroism (CD) spectroscopy to examine secondary structure elements characteristic of CBS domains. Fourth, consider thermal shift assays to evaluate protein stability and proper folding. For more detailed structural information, advanced techniques such as limited proteolysis followed by mass spectrometry can identify properly folded domains. Additionally, functional assays that test the protein's ability to bind adenosine derivatives or other small molecules can provide indirect evidence of correct folding and biological activity. Each verification step should be documented with appropriate controls to ensure reliable interpretation .

How do CBS domains in CBSCBSPB2 contribute to regulatory mechanisms in Arabidopsis?

The CBS domains in CBSCBSPB2 likely function as regulatory modules that sense the energy status of the cell through binding to adenosine derivatives or other metabolites. When examining the amino acid sequence of CBSCBSPB2, we observe conserved residues typical of CBS domains that facilitate this binding capability . The binding of metabolites to CBS domains induces conformational changes that can either activate or inhibit associated protein functions. In some CBS domain-containing proteins, these domains form autoinhibitory regions that regulate enzymatic activity through ligand-induced structural changes .

This regulatory mechanism allows Arabidopsis to respond to changing environmental conditions by modulating metabolic pathways. Research on other CBS domain-containing proteins in plants has shown that they contribute to stress responses, including adaptation to drought, salinity, cold, and heat stresses, by altering gene expression patterns and metabolic adjustments . The specific regulatory targets of CBSCBSPB2 remain to be fully characterized, but based on sequence homology with other CBS proteins, it likely participates in similar cellular regulatory networks.

What is known about the relationship between CBSCBSPB2 and plant stress responses?

While specific data on CBSCBSPB2's stress response role is limited, research on other CBS domain-containing proteins in Arabidopsis provides insight into probable functions. CBS domain-containing proteins show altered expression patterns under various stress conditions including salinity, drought, cold, high temperature, UV, wounding, and genotoxic stress in both root and shoot tissues . The regulatory capacity of CBS domains allows these proteins to modulate cellular responses to stress conditions.

The table below summarizes common stress responses associated with CBS domain-containing proteins in Arabidopsis:

Stress TypeTypical ResponseCellular Mechanism
SalinityExpression changes in CBS proteinsModulation of ion transport and osmotic adjustment
DroughtUpregulation of specific CBS genesRegulation of water use efficiency and ABA signaling
Temperature (cold/heat)Dynamic expression patternsMetabolic adjustments to maintain energy homeostasis
Oxidative stressEnhanced CBS protein activityRegulation of redox balance and antioxidant systems
Pathogen attackChanges in CBS-mediated splicingAlternative splicing affecting defense gene expression

CBSCBSPB2 likely participates in these stress response pathways through similar mechanisms, potentially serving as a metabolic sensor that helps coordinate appropriate cellular responses to environmental challenges .

How does CBSCBSPB2 interact with other proteins in the Arabidopsis proteome?

Although direct interaction data for CBSCBSPB2 is limited, CBS domain-containing proteins typically function within complex protein networks. Based on studies of other CBS proteins, CBSCBSPB2 likely interacts with proteins involved in metabolic regulation, stress response pathways, and potentially RNA processing mechanisms. The CBS domains may serve as interaction interfaces, allowing CBSCBSPB2 to form functional complexes with other cellular proteins in a ligand-dependent manner .

To investigate these interactions experimentally, researchers should consider employing techniques such as:

  • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Yeast two-hybrid screens to map the interactome

  • Bimolecular fluorescence complementation to visualize interactions in vivo

  • Protein microarrays to detect multiple potential interactions simultaneously

When designing such experiments, particular attention should be paid to maintaining native-like conditions, as CBS domain interactions are often dependent on cellular metabolites and energy status .

What are the methodological approaches for investigating CBSCBSPB2's role in alternative splicing?

Research on Arabidopsis coilin has revealed significant involvement of nuclear proteins in alternative splicing (AS) regulation, suggesting that CBS domain-containing proteins like CBSCBSPB2 may also influence RNA processing . To investigate this potential role, researchers should implement a comprehensive experimental strategy combining genomic, transcriptomic, and biochemical approaches.

First, RNA-seq analysis comparing wild-type plants with CBSCBSPB2 knockout or overexpression lines should be performed, focusing on identifying differential splicing patterns. Tools like rMATS (version 3.2.5 or later) can be used to detect various splicing event types, including alternative 3'-splice sites (A3SSs), alternative 5′-splice sites (A5SSs), skipped exons (SE), mutually exclusive exons (MXE), and intron retention (IR) events .

Second, RNA immunoprecipitation (RIP) followed by sequencing can identify RNAs directly associated with CBSCBSPB2. Third, in vitro splicing assays using recombinant CBSCBSPB2 can test direct effects on splicing efficiency. Finally, proteomic approaches should be employed to identify interactions between CBSCBSPB2 and known splicing factors or spliceosomal components.

When analyzing the results, researchers should pay particular attention to intron retention events, as these constitute the majority of alternative splicing events in Arabidopsis .

How can CRISPR-Cas9 be utilized to study CBSCBSPB2 function in Arabidopsis?

CRISPR-Cas9 gene editing provides a powerful approach for investigating CBSCBSPB2 function through precise genetic modifications. When designing a CRISPR-Cas9 strategy for CBSCBSPB2, researchers should consider multiple aspects to ensure effective functional analysis.

First, design several guide RNAs targeting conserved regions within the CBS domains to ensure complete loss of function. The Arabidopsis genome assembly (TAIR10) and Araport11 annotation data should be used to identify target sequences with minimal off-target potential . For more nuanced functional studies, consider creating specific point mutations in key residues of the CBS domains rather than complete gene knockout.

Second, implement appropriate transformation methods for Arabidopsis, such as floral dip with Agrobacterium tumefaciens carrying the CRISPR-Cas9 constructs. Third, establish a thorough screening pipeline to identify and validate edited plants through sequencing and expression analysis.

For phenotypic characterization, examine edited plants under various stress conditions (drought, salinity, temperature extremes, pathogen exposure) based on known responses of CBS domain-containing proteins . Compare transcriptome profiles between wild-type and edited plants to identify genes with altered expression or splicing patterns. Additionally, analyze metabolite profiles, particularly focusing on adenosine derivatives and energy-related compounds that might interact with CBS domains .

How does CBSCBSPB2 compare structurally and functionally to CBSCBSPB3 and other CBS domain-containing proteins?

CBSCBSPB2 and CBSCBSPB3 share significant structural similarities while maintaining distinct features that may indicate specialized functions. Both proteins contain CBS domains arranged in similar configurations, but differ in specific amino acid sequences that may affect ligand binding preferences and protein-protein interactions. Comparing their amino acid sequences reveals conserved motifs characteristic of CBS domains while highlighting protein-specific variations .

CBSCBSPB2 contains 556 amino acids with its sequence beginning with MTTTPTSSGRRSISSIRRT, while CBSCBSPB3 is 556 amino acids long with a sequence beginning with MSTQATGPSSTSGRRSNST . Both proteins feature similar domain organization with CBS domains that likely function in metabolite sensing and protein regulation.

In the broader context of Arabidopsis CBS domain-containing proteins, these proteins belong to a family that includes 34 members classified into different subgroups based on domain architecture . Some CBS proteins contain additional functional domains such as voltage chloride channels or CorC_HlyC domains that confer specific cellular functions beyond the regulatory capacity of the CBS domains themselves.

From an evolutionary perspective, CBS domains are highly conserved across species, suggesting fundamental roles in cellular metabolism. The specialization of proteins like CBSCBSPB2 and CBSCBSPB3 likely represents adaptations to specific plant physiological needs or environmental challenges .

What evolutionary insights can be gained from studying CBSCBSPB2 across different plant species?

Evolutionary analysis of CBSCBSPB2 across plant species provides valuable insights into the conservation and diversification of CBS domain functions in plant adaptation. CBS domain-containing proteins are found in diverse organisms from bacteria to humans, with the number and complexity of these proteins generally increasing with organismal complexity. In plants, the CBS domain family has undergone significant expansion, with Arabidopsis containing 34 members and rice (Oryza sativa) having 59 members .

To study the evolutionary trajectory of CBSCBSPB2, researchers should:

  • Perform comprehensive phylogenetic analysis using homologs identified in diverse plant species, ranging from mosses and ferns to gymnosperms and angiosperms

  • Compare domain architectures across species to identify conserved structural elements and species-specific innovations

  • Analyze selection pressure on different protein regions to identify domains under purifying or diversifying selection

  • Correlate protein evolution with species adaptation to different environmental niches

This comparative approach can reveal how CBS domain functions have been maintained or modified throughout plant evolution. For instance, comparative studies between Arabidopsis and rice have already shown both conservation of core CBS domain functions and species-specific adaptations . The expansion of the CBS protein family in plants compared to other organisms suggests these proteins have acquired specialized roles in plant-specific processes, potentially related to photosynthesis, unique stress responses, or plant-specific developmental pathways.

What emerging technologies could advance our understanding of CBSCBSPB2 function?

Several cutting-edge technologies show promise for elucidating CBSCBSPB2 function in Arabidopsis. Cryo-electron microscopy offers unprecedented resolution for determining the three-dimensional structure of CBSCBSPB2, particularly in complex with interacting proteins or metabolites. This structural information would provide critical insights into how CBS domains mediate conformational changes in response to ligand binding .

Proximity labeling techniques such as BioID or TurboID can map the protein interaction neighborhood of CBSCBSPB2 in living cells, identifying transient or context-specific interactions that traditional co-immunoprecipitation might miss. These approaches are particularly valuable for understanding dynamic protein complexes that form under specific cellular conditions or stress responses .

Single-cell transcriptomics and proteomics can reveal cell type-specific functions of CBSCBSPB2, potentially uncovering specialized roles in different plant tissues. This approach is especially relevant given the differential expression patterns observed for CBS domain-containing proteins under various stress conditions .

Metabolomics combined with protein-metabolite interaction studies can identify the specific cellular metabolites that bind to CBSCBSPB2's CBS domains, providing direct evidence for its role as a metabolic sensor. Finally, optogenetic approaches that allow light-controlled activation or inhibition of CBSCBSPB2 could enable precise temporal manipulation of its function to study downstream effects in real-time.

What are the major unresolved questions regarding CBSCBSPB2 and how might they be addressed?

Several critical questions about CBSCBSPB2 remain unresolved, presenting opportunities for significant research contributions. First, the specific ligands that bind to CBSCBSPB2's CBS domains remain unidentified. This could be addressed through metabolite binding assays, thermal shift assays in the presence of candidate molecules, and structural studies of ligand-bound versus unbound states .

Second, the downstream targets regulated by CBSCBSPB2 are unknown. Comprehensive transcriptome and proteome profiling in knockout/knockdown versus overexpression lines could identify genes and proteins affected by CBSCBSPB2 activity. Chromatin immunoprecipitation sequencing (ChIP-seq) could determine if CBSCBSPB2 associates with chromatin to directly regulate gene expression .

Third, the physiological conditions under which CBSCBSPB2 is most active remain unclear. Systematic phenotyping of CBSCBSPB2 mutants under various stress conditions, combined with tissue-specific and subcellular localization studies, could reveal when and where CBSCBSPB2 functions are most critical .

Fourth, the evolutionary significance of CBSCBSPB2's conservation across plant species requires further investigation. Complementation studies introducing CBSCBSPB2 orthologs from diverse plant species into Arabidopsis mutants could determine functional conservation across evolutionary distance.

Finally, the potential role of CBSCBSPB2 in alternative splicing regulation suggested by studies of related proteins needs direct investigation through RNA-seq analysis of splicing patterns in CBSCBSPB2 mutants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.