Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB4 (CBSCBSPB4)

Shipped with Ice Packs
In Stock

Description

Introduction to CBSCBSPB4

CBSCBSPB4 is a protein encoded by the At5g50530 gene in Arabidopsis thaliana, a model organism widely used in plant research. The protein has been identified as a member of the CBS domain-containing protein family, which can be classified into several subclasses including CBSX, CBSCLC, CBSSIS, CBSPPR, CBSIMPDH, CBSCBS, CBSCBSPB, and CBSDUF . These various subclasses perform diverse functions including cytoplasmic targeting, subcellular localization of chloride channels, protein-protein interaction, protein regulation, sensing of cellular energy status, and maintenance of intracellular ion gradients .

The CBS domain, named after the human cystathionine β-synthase protein where it was first identified, is an evolutionarily conserved protein motif that occurs in proteins across diverse organisms from bacteria to humans. These domains often function as regulatory units that can bind adenosine nucleotides and consequently sense cellular energy status.

Post-translational Modifications

Post-translational modifications (PTMs) play critical roles in regulating protein function, localization, and interactions. For CBSCBSPB4, numerous phosphorylation sites have been identified through proteomic studies. These modifications likely serve as regulatory mechanisms that can alter the protein's function, activity, and interactions with other biomolecules in response to various cellular signals.

The following table presents the identified phosphorylation sites in CBSCBSPB4 as documented in the PhosPhAt database and UniProt:

SitePTM TypeSource
S11PhosphorylationPhosPhAt
S13PhosphorylationPhosPhAt
S15PhosphorylationPhosPhAt
S18PhosphorylationPhosPhAt, UniProt
T45PhosphorylationPhosPhAt
S49PhosphorylationPhosPhAt
S50PhosphorylationPhosPhAt
S52PhosphorylationPhosPhAt
S54PhosphorylationPhosPhAt
S229PhosphorylationPhosPhAt
S231PhosphorylationPhosPhAt
T232PhosphorylationPhosPhAt
Y259PhosphorylationPhosPhAt
S261PhosphorylationPhosPhAt
T389PhosphorylationPhosPhAt
S391PhosphorylationPhosPhAt
S400PhosphorylationPhosPhAt
S407PhosphorylationPhosPhAt

The presence of multiple phosphorylation sites, particularly clustered in certain regions of the protein, suggests that CBSCBSPB4 may be subject to complex regulation through phosphorylation events in response to various developmental and environmental cues.

Functional Significance in Plant Biology

While the specific functions of CBSCBSPB4 have not been fully characterized, research on related CBS domain-containing proteins provides valuable insights into its potential roles in plant biology.

Stress Response Functions

CBS domain-containing proteins have been implicated in plant responses to various abiotic stresses. Research on soybean CBSDUF proteins, which share structural similarities with CBSCBSPB4, revealed that certain members of this protein family are likely involved in specific stress responses . For instance, RNA-seq transcriptome data analysis has shown differential expression profiles of CBS domain-containing proteins under various stress conditions, suggesting their involvement in stress adaptation mechanisms .

Most notably, overexpression studies of specific CBS domain-containing proteins have demonstrated enhanced tolerance to drought and salt stress in Arabidopsis . This suggests that CBSCBSPB4 might play a role in the plant's ability to withstand adverse environmental conditions, potentially through mechanisms related to energy sensing or ion transport regulation.

Developmental Roles

CBS domain-containing proteins have also been associated with developmental processes in plants. In Arabidopsis, certain CBS domain-containing proteins interact with other regulatory proteins involved in developmental pathways. Although the specific developmental functions of CBSCBSPB4 have not been directly characterized, its structural features suggest potential roles in developmental processes that require energy sensing or metabolic regulation .

Cellular Energy Sensing

The CBS domains in CBSCBSPB4 likely function as sensors of cellular energy status through their ability to bind adenosine nucleotides (ATP, ADP, AMP). This sensing mechanism allows the protein to potentially regulate various cellular processes in response to changes in energy levels. The sensing of cellular energy status is particularly important for plants to adapt their metabolism and growth in response to environmental changes and stresses .

Expression and Purification Systems

Recombinant CBSCBSPB4 protein has been successfully expressed using Escherichia coli expression systems. The protein is typically produced with an N-terminal His tag to facilitate purification using affinity chromatography techniques . This approach allows for the isolation of pure protein suitable for various research applications.

The recombinant protein is supplied as a lyophilized powder with high purity (greater than 90% as determined by SDS-PAGE analysis). The storage buffer typically contains Tris/PBS with 6% Trehalose at pH 8.0, which helps maintain protein stability during storage .

Research Applications

Recombinant CBSCBSPB4 serves various research purposes in plant molecular biology:

  1. Structural Studies: The purified protein can be utilized for three-dimensional structure determination through techniques such as X-ray crystallography.

  2. Functional Assays: Recombinant CBSCBSPB4 can be employed to investigate its potential roles in stress response, energy sensing, and developmental processes through in vitro biochemical assays.

  3. Protein-Protein Interaction Studies: The protein can be used to identify and characterize interaction partners, providing insights into the molecular networks in which CBSCBSPB4 participates.

  4. Antibody Production: The purified recombinant protein serves as an excellent antigen for antibody development, which can subsequently be used for immunoblotting, immunoprecipitation, and immunohistochemistry.

  5. Transgenic Studies: Knowledge gained from recombinant protein studies can inform transgenic approaches to investigate CBSCBSPB4 function in planta.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format during the order placement, and we will ensure your order is fulfilled accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To optimize long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles for optimal protein integrity.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you have a particular tag preference, please inform us, and we will prioritize incorporating it into your order.
Synonyms
CBSCBSPB4; At5g50530; MBA10.9; CBS domain-containing protein CBSCBSPB4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CBSCBSPB4
Target Protein Sequence
MANQGGPSRKSLSFSGHSFQGRKKASENEGGGGGGSDLLPRRSLTSSRSSISLSGERSGE RTVKRLRLCKALTVPDSTTLFEACRRMAARRVDALLLTDSNALLCGILTDRDIATKVIAK QLNLEETPVSKVMTKNPVFVLSDTIAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLY DAIARMERSVEKGKAIAAAVEGVEKNWGTSIAGPNTFMETLRERIFKPSLSTIIPENTKV LKVGLDETVLGVTMKMVEYQSSAAMVMVENKLVGILTSKDILMRVISQNLPQETTTVEKV MTPNPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAG INNETANSMMQKFWDSAMALSPNEDGDETRSEEESMKLSSEIEVTKSFSYPNTFAFKLQD KKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLGAAV EHAKSIGWKGLKLHLDYTEERGHRRGLSSEDMDYDQSNSWAAAYKTVAAGAALAAGLGVL VYLKRNSN
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G50530

STRING: 3702.AT5G50640.1

UniGene: At.29723

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CBSCBSPB4 and why is it significant in plant biology research?

CBSCBSPB4 is a CBS (Cystathionine β-synthase) domain-containing protein found in Arabidopsis thaliana. It belongs to a larger family of CBS domain-containing proteins (CDCPs) that are present across all three domains of life: archaea, bacteria, and eukaryotes . This protein is significant in plant biology research because CBS domains play critical regulatory roles for many enzymes and help maintain intracellular redox balance .

The protein has been identified as part of extensive genomic analysis of Arabidopsis, which is currently the most-studied plant species on earth with an unprecedented number of genetic, genomic, and molecular resources . Understanding CBSCBSPB4's function contributes to our knowledge of plant regulatory networks, particularly those involved in stress responses and cellular energy sensing, making it valuable for translational research and agricultural applications .

How does CBSCBSPB4 compare to other CBS domain-containing proteins in Arabidopsis?

In Arabidopsis thaliana, there are 34 CBS domain-containing proteins encoded by 33 genes, while in rice (Oryza sativa), there are 59 proteins encoded by 37 genes . These proteins can be classified into two major groups:

  • Proteins containing a single CBS domain

  • Proteins containing two CBS domains

CBSCBSPB4 belongs to the CBSCBSPB subgroup, which contains two CBS domains and one PB1 (Phox and Bem1p) domain . This classification is based on the structural features and domain organization of the proteins.

A comprehensive analysis of the Arabidopsis CBS domain-containing proteins revealed that they can be further classified into several subgroups based on additional structural domains that may co-exist with the CBS domain(s). These additional domains include:

  • CorC_HlyC

  • Voltage chloride channel (CLC)

  • Sugar isomerase (SIS)

  • Pentatricopeptide repeats (PPR)

  • Phox and Bem1p (PB1)

  • Inosine monophosphate dehydrogenase (IMPDH)

  • Domain of unknown function (DUF21)

The presence of these additional domains suggests diverse functional roles for different CBS domain-containing proteins in plant cellular processes.

What experimental methods are most effective for producing recombinant CBSCBSPB4 protein?

For producing recombinant CBSCBSPB4 protein, researchers have utilized several effective approaches:

Expression Systems:

  • E. coli expression systems have been widely used for CBS domain-containing proteins due to their high yield and relatively straightforward purification protocols .

  • For plant-derived proteins like CBSCBSPB4, a codon-optimized sequence for the expression host is recommended to enhance protein yield .

Purification Strategy:

  • Affinity chromatography using histidine tags is commonly employed for initial purification

  • Size exclusion chromatography for further purification and to ensure proper folding

  • Ion exchange chromatography may be used as an additional purification step

Quality Control Considerations:

  • When expressing CBSCBSPB4, researchers should monitor protein solubility as CBS domain-containing proteins can sometimes form inclusion bodies

  • Optimizing expression temperature (typically lower temperatures of 16-18°C) and using solubility-enhancing fusion tags can improve yield of properly folded protein

  • Storage in 50% glycerol in Tris-based buffer as recommended for maintaining stability

For researchers conducting functional studies, it's crucial to ensure that the recombinant protein retains native activity. Circular dichroism spectroscopy can be used to verify proper folding, while functional assays examining adenosine-containing ligand binding (AMP, ATP) should be performed to confirm biological activity .

How do environmental stresses affect CBSCBSPB4 expression in Arabidopsis?

The expression of CBS domain-containing proteins, including CBSCBSPB4, is significantly modulated in response to various environmental stresses. Based on genome-wide expression analyses, several stress conditions that affect CBSCBSPB4 expression have been identified:

Drought Stress:
Transcriptomic analyses of Arabidopsis under drought conditions have shown that CBS domain-containing proteins are involved in drought response pathways . When subjected to water limitation for 5 days, significant changes in gene expression were observed, with over 1,900 and 1,793 drought-responsive genes identified in roots and shoots, respectively .

Salt and Osmotic Stress:
Studies comparing different osmotic stressors (PEG, mannitol, and NaCl) revealed that CBS domain-containing proteins are differentially expressed under these conditions . Each treatment led to over 800 differentially expressed genes, with expression responses generally dose-responsive to the severity of stress .

Temperature Stress:
CBS domain-containing proteins have shown altered expression under both cold and high-temperature conditions, suggesting their involvement in temperature stress response mechanisms .

Root System Architecture (RSA) Development Under Stress:
Research on RSA in 241 Arabidopsis accessions demonstrated significant variability in root development under water-limiting conditions, which correlated with differences in CBS domain-containing protein expression profiles . This suggests that CBSCBSPB4 and related proteins may play roles in adapting root architecture to environmental stresses.

Researchers investigating CBSCBSPB4's role in stress responses should consider using the "low-water agar assay" protocol described by researchers, which provides a controlled environment for studying drought responses in Arabidopsis . This method allows for precise manipulation of water content in growth media and has successfully replicated field-observed drought responses in laboratory conditions.

What is the relationship between CBSCBSPB4 and thioredoxin regulation in plant cells?

CBSCBSPB4 and other CBS domain-containing proteins in Arabidopsis have been implicated in the regulation of thioredoxins (Trxs), which are key components of cellular redox regulation systems . Based on research findings:

  • Redox Regulation Mechanism: CBS domain-containing proteins like CBSCBSPB4 can activate thioredoxins, particularly enhancing their enzymatic activity in the presence of AMP . This suggests that CBSCBSPB4 functions as a redox regulator that modulates Trxs for development and maintaining cellular homeostasis under stressful conditions.

  • Chloroplast and Mitochondrial Regulation: While CBSCBSPB1 and CBSCBSPB2 have been shown to localize to chloroplasts and regulate chloroplastic Trxs in the Ferredoxin-Thioredoxin System (FTS), CBSCBSPB3 regulates mitochondrial Trx members in the NADPH-Thioredoxin System (NTS) . The specific localization and interaction partners of CBSCBSPB4 require further investigation, but it likely plays a similar regulatory role in specific cellular compartments.

  • H₂O₂ Level Regulation: CBS domain-containing proteins directly regulate Trxs and thereby control H₂O₂ levels in plant cells. For example, CBSCBSPB1 affects lignin polymerization in the anther endothecium through regulating H₂O₂ levels . CBSCBSPB4 may have similar regulatory functions in specific tissues or developmental stages.

  • Metabolic Enzyme Regulation: CBS domain-containing proteins can regulate the Calvin cycle enzymes, such as malate dehydrogenase, via homeostatic regulation of Trxs . This connection to primary metabolism suggests CBSCBSPB4 may be involved in coordinating energy metabolism with redox status in plant cells.

To study these interactions experimentally, researchers should consider using yeast two-hybrid assays to identify direct protein interactions, followed by in vitro enzyme assays to measure Trx activity in the presence and absence of recombinant CBSCBSPB4 and adenosine-containing ligands.

What methodologies are most effective for studying CBSCBSPB4 function in vivo?

Several complementary methodologies have proven effective for studying the function of CBS domain-containing proteins like CBSCBSPB4 in vivo:

Genetic Approaches:

  • CRISPR-Cas9 Gene Editing: Creating precise knockouts or mutations in the CBSCBSPB4 gene to assess loss-of-function phenotypes

  • Overexpression Studies: Generating transgenic lines overexpressing CBSCBSPB4 under constitutive or inducible promoters to observe gain-of-function effects

  • Promoter-Reporter Fusions: Creating CBSCBSPB4 promoter:GUS or CBSCBSPB4 promoter:GFP fusions to monitor expression patterns in different tissues and under various stress conditions

Subcellular Localization:
Fusion of CBSCBSPB4 with fluorescent proteins like GFP has been used to determine its subcellular localization. Previous studies with related proteins have utilized the 35S promoter to drive expression of CBS-smGFP fusion proteins, allowing visualization of their localization to specific organelles . Based on gene ontology data in The Arabidopsis Information Resource (TAIR) database and ChloroP program predictions, similar approaches could be applied to CBSCBSPB4 .

Physiological Analysis:
For studying CBSCBSPB4's role in stress responses, several experimental systems have proven effective:

  • Vertical Plate Assays: Growing seedlings on vertical plates with varying media compositions (e.g., drought simulation using PEG, mannitol, or reduced water content) to assess root and shoot development .

  • Rhizotron Systems: For advanced root architecture studies, rhizotron boxes that allow visualization of root growth in soil-like conditions can be used . This system has been particularly valuable for comparing wild-type and mutant lines under different water availability conditions.

  • Low-Water Agar Assay: This method uses varying water content in agar media to simulate drought conditions and has been shown to correlate well with field-observed drought responses .

Molecular Interaction Studies:

  • Co-Immunoprecipitation: To identify interaction partners of CBSCBSPB4 in vivo

  • BiFC (Bimolecular Fluorescence Complementation): For visualizing protein-protein interactions in living cells

  • Proteomic Approaches: Mass spectrometry-based identification of CBSCBSPB4-associated protein complexes

These methodologies, particularly when used in combination, provide a comprehensive understanding of CBSCBSPB4 function in plant development, stress responses, and cellular redox regulation.

How can CBSCBSPB4 research contribute to crop improvement strategies?

Research on CBSCBSPB4 and other CBS domain-containing proteins has significant potential for translational applications in crop improvement:

Drought and Stress Resilience:
Studies of Arabidopsis accessions with contrasting root system architecture (RSA) under water-limiting conditions have demonstrated significant natural variation in drought responses . For example, the accession Had-1b exhibited a deeper-growing root system with more lateral roots in lower zones, suggesting an evolutionary adaptation for water-seeking behavior . Understanding how CBSCBSPB4 contributes to these adaptive root architectures could inform breeding strategies for drought-resistant crops.

Metabolic Engineering:
The role of CBS domain-containing proteins in regulating Trxs and Calvin cycle enzymes suggests potential applications in manipulating photosynthetic efficiency and carbon fixation in crops . By modulating CBSCBSPB4 expression or activity, it may be possible to enhance crop productivity under suboptimal conditions.

Translational Research Framework:
Arabidopsis research has provided invaluable tools for applied plant biology, as highlighted in recent reviews . The extensive genetic and genomic resources available for Arabidopsis make it an ideal model for identifying and validating genes like CBSCBSPB4 for subsequent transfer to crop species.

Experimental Approaches for Translational Research:

  • Comparative Genomics: Identify CBSCBSPB4 orthologs in crop species using bioinformatic approaches

  • Genome Editing: Use CRISPR-Cas9 to modify expression or function of CBSCBSPB4 orthologs in crops

  • Field Trials: Test modified lines under various environmental conditions to assess stress resilience and yield stability

Case Study: Root Architecture Improvement
Research has demonstrated that RSA traits have a genetic basis that can be mapped through genome-wide association studies (GWAS) . In a study of 241 Arabidopsis accessions, significant variation in root traits correlated with adaptation to different soil and climate conditions:

RSA TraitCorrelation with Geographic/Climate FeaturesCorrelation with Soil Types
Convex AreaModerate correlation with precipitationVaries by soil taxonomy
Root DepthStrong correlation with temperatureHigher in certain soil types
Lateral Root NumberCorrelation with temperature variationSoil-dependent differences

These findings suggest that CBSCBSPB4 and related proteins that influence root development could be targeted for crop improvement strategies focused on enhancing water and nutrient uptake efficiency .

What are the best methods for analyzing CBSCBSPB4 expression patterns across different tissues and developmental stages?

For comprehensive analysis of CBSCBSPB4 expression patterns, a multi-faceted approach combining various techniques is recommended:

Transcriptomic Analysis:

  • RNA-Seq: For genome-wide expression profiling across tissues, developmental stages, and stress conditions. This approach provides quantitative expression data and can identify alternative splicing events .

  • qRT-PCR: For targeted validation of expression patterns in specific tissues or under particular conditions. This method offers higher sensitivity for low-abundance transcripts and is suitable for time-course studies .

  • MPSS (Massively Parallel Signature Sequencing): Public MPSS databases have been used to analyze expression patterns of CBS domain-containing proteins in Arabidopsis and rice .

Promoter Analysis:

  • Promoter-Reporter Constructs: Fusing the CBSCBSPB4 promoter region to reporter genes like GUS or fluorescent proteins allows visualization of spatial and temporal expression patterns in transgenic plants .

  • Deletion Analysis: Creating a series of promoter deletions can help identify key regulatory elements controlling tissue-specific or stress-responsive expression .

Protein Localization:

  • Immunohistochemistry: Using specific antibodies against CBSCBSPB4 for tissue localization studies .

  • Translational Fusions: Creating CBSCBSPB4-GFP fusion proteins under the control of the native promoter to visualize protein localization while maintaining native expression patterns .

Public Database Mining:
Several public databases can be utilized to analyze existing expression data:

  • The Arabidopsis Information Resource (TAIR)

  • eFP Browser for visualization of expression patterns

  • AtGenExpress for stress response data

  • Plant Proteome Database for protein localization information

For developmental analysis, it's particularly important to examine expression during key transitions (germination, vegetative growth, flowering) and in response to environmental stresses, as CBS domain-containing proteins have been implicated in both developmental regulation and stress responses .

How can researchers accurately assess the impact of CBSCBSPB4 mutations on plant phenotypes under varying environmental conditions?

To accurately assess the impact of CBSCBSPB4 mutations on plant phenotypes across different environments, researchers should implement a comprehensive experimental design that addresses genetic, environmental, and developmental variables:

Genetic Material Preparation:

  • Generate Multiple Allelic Variants: Create several independent mutant lines using CRISPR-Cas9 or T-DNA insertion approaches to ensure phenotypes are not due to off-target effects

  • Complementation Lines: Develop genetic complementation lines expressing the wild-type CBSCBSPB4 in mutant backgrounds to confirm phenotypes are specifically due to CBSCBSPB4 disruption

  • Natural Variation Analysis: Include diverse Arabidopsis accessions to assess how genetic background affects CBSCBSPB4 function

Environmental Condition Matrix:
Based on research showing CBS domain-containing proteins respond to various stresses, design experiments that systematically vary:

  • Water Availability: Using both controlled soil moisture conditions and the validated low-water agar assay for comparing drought responses

  • Temperature Regimes: Test both optimal and stress temperatures (cold and heat)

  • Light Conditions: Vary intensity and photoperiod to assess photosynthetic impacts

  • Nutrient Availability: Particularly relevant given the potential role in metabolic regulation

Phenotyping Approaches:

  • High-Throughput Phenotyping: Use automated imaging systems to track growth parameters (rosette area, plant height, flowering time) across conditions

  • Root System Architecture Analysis: Employ the GiA Roots software to measure multiple RSA traits, as used in previous studies :

RSA TraitDescriptionMeasurement Method
Length DistributionSpatial distribution of root lengthGiA Roots software
Projected AreaTotal area covered by the root systemGiA Roots software
Convex AreaArea of the convex hull containing the root systemGiA Roots software
SolidityRatio of root area to convex areaGiA Roots software
Total Root LengthCumulative length of all rootsGiA Roots software
Root WidthHorizontal spread of the root systemImageJ script
Root DepthVertical extent of the root systemImageJ script
Total Lateral Root NumberCount of all lateral rootsAutomated counting
  • Physiological Measurements:

    • Gas exchange parameters to assess photosynthetic efficiency

    • Water use efficiency measurements

    • Biomass accumulation (fresh and dry weights of shoots and roots)

  • Cellular and Biochemical Analyses:

    • H₂O₂ levels to assess redox status changes

    • Thioredoxin activity assays

    • Lignin content analysis

Statistical Analysis:

  • Implement robust statistical methods like ANOVA with appropriate post-hoc tests to assess significance of phenotypic differences

  • Use multivariate analyses to identify correlations between different phenotypic traits

  • Employ mixed-effect models to account for random effects in experimental designs

By combining these approaches, researchers can comprehensively characterize how CBSCBSPB4 mutations affect plant development and stress responses across varied environmental conditions, providing insights into its functional roles and potential applications in crop improvement.

How do researchers resolve contradictory findings regarding CBSCBSPB4 function in different experimental systems?

When faced with contradictory findings regarding CBSCBSPB4 function, researchers should employ a systematic approach to resolve discrepancies:

Critical Analysis of Experimental Systems:

  • Compare Genetic Backgrounds: Different Arabidopsis accessions show significant natural variation in root system architecture and stress responses . Contradictory results may stem from using different genetic backgrounds, as studies have shown that RSA traits can vary widely among accessions .

  • Evaluate Growth Conditions: Results from plate-based assays may differ from soil-based or field experiments. Research has shown that drought responses observed in controlled laboratory conditions should be validated in more realistic settings . For instance, the rhizotron system provides a more soil-like environment than agar plates and may yield different phenotypes .

  • Consider Developmental Timing: CBS domain-containing proteins may have stage-specific functions. For example, Had-1b accession showed extended vegetative growth and delayed flowering, suggesting that some contradictory findings might be explained by examining different developmental stages .

Methodological Reconciliation Approaches:

  • Direct Experimental Comparison: Reproduce contradictory findings side-by-side in the same laboratory using identical protocols to identify specific variables causing discrepancies

  • Meta-Analysis: Synthesize results from multiple studies to identify patterns and potential sources of variation

  • Molecular Mechanism Investigation: Delve deeper into molecular pathways to explain contextual differences in function:

    • Protein interaction partners might differ between tissues or conditions

    • Post-translational modifications could alter function in different contexts

    • Splice variants may have distinct functions

Case Study in Resolving Contradictions:
Researchers studying CBS domain-containing proteins noted apparent contradictions in drought response phenotypes between artificial media and soil conditions. By developing the low-water agar assay that more accurately mimics genuine drought responses, they were able to reconcile these differences . Their approach validated that proper simulation of drought stress in laboratory conditions can produce results consistent with field observations, with a significant correlation between relative impact on shoot size in their assay and drought impact on fitness measured under field conditions (Spearman rho = -0.46, p = 0.04) .

To resolve contradictions specific to CBSCBSPB4, researchers should:

  • Standardize experimental conditions when possible

  • Explicitly test hypotheses about context-dependent functions

  • Consider redundancy with other CBS domain-containing proteins that might mask phenotypes in certain conditions

  • Employ combinatorial mutants to address functional redundancy

What bioinformatic approaches are most valuable for predicting CBSCBSPB4 function and interaction partners?

To effectively predict CBSCBSPB4 function and interaction partners, researchers should employ a multi-layered bioinformatic approach:

Sequence Analysis and Evolutionary Insights:

  • Domain Architecture Analysis: Examine the arrangement of CBS domains and additional functional domains (PB1 in the case of CBSCBSPB4) to predict functional capabilities

  • Phylogenetic Analysis: Construct phylogenetic trees of CBS domain-containing proteins across species to identify evolutionary relationships and potential functional conservation . This approach has been used to classify the 34 CDCPs in Arabidopsis and 59 in rice into distinct subfamilies .

  • Motif Identification: Analyze sequence motifs that might indicate binding sites for regulatory molecules, particularly adenosine-containing ligands like AMP and ATP that are known to interact with CBS domains

Structural Bioinformatics:

  • Protein Structure Prediction: Use AlphaFold2 or similar tools to predict the three-dimensional structure of CBSCBSPB4, with particular focus on the CBS domain pair formation and potential binding pockets

  • Molecular Docking: Simulate interactions with potential ligands (AMP, ATP, S-adenosylmethionine) and predict binding affinities

  • Molecular Dynamics Simulations: Model conformational changes upon ligand binding to understand regulatory mechanisms

Network Analysis:

  • Protein-Protein Interaction Prediction: Tools like STRING database can be used to predict interaction partners based on:

    • Co-expression patterns

    • Experimental interaction data

    • Text mining of scientific literature

    • Conserved gene neighborhoods

  • Gene Co-expression Network Analysis: Identify genes with expression patterns correlated with CBSCBSPB4 across various conditions and tissues to predict functional relationships

  • Pathway Enrichment Analysis: Determine which biological pathways are statistically overrepresented among predicted interaction partners

Machine Learning Approaches:

  • Function Prediction: Supervised learning algorithms trained on characterized proteins can predict potential functions based on sequence and structural features

  • Protein-Protein Interaction Prediction: Deep learning approaches that integrate multiple data types can improve prediction accuracy for interaction partners

Integration with Experimental Data:
The most powerful approach combines bioinformatic predictions with experimental validation:

  • Y2H Screening: Use predicted interaction partners to guide focused yeast two-hybrid screens

  • Co-IP-MS Validation: Confirm predicted interactions using co-immunoprecipitation followed by mass spectrometry

  • BiFC Visualization: Visualize predicted interactions in planta using bimolecular fluorescence complementation

For CBSCBSPB4 specifically, researchers should pay particular attention to potential interactions with thioredoxins, given the established role of other CBS domain-containing proteins in regulating thioredoxin activity , and with components of stress response pathways, based on the differential expression of CBS domain-containing genes under various stress conditions .

How can findings from CBSCBSPB4 research in Arabidopsis be effectively translated to crop species?

Translating CBSCBSPB4 research from Arabidopsis to crop species requires a strategic approach that bridges model system discoveries with agricultural applications:

Comparative Genomics Pipeline:

  • Ortholog Identification: Identify CBSCBSPB4 orthologs in target crop species using reciprocal BLAST searches and synteny analysis

  • Domain Conservation Analysis: Determine if structural features (CBS domains, PB1 domain) are conserved in crop orthologs

  • Expression Pattern Comparison: Compare tissue-specific and stress-responsive expression patterns between Arabidopsis CBSCBSPB4 and crop orthologs

Functional Validation in Crops:

  • Genetic Modification Approaches:

    • CRISPR-Cas9 editing of orthologous genes

    • Overexpression of Arabidopsis CBSCBSPB4 in crop species

    • RNAi-mediated knockdown in crops where knockouts might be lethal

  • Phenotypic Evaluation:

    • Stress tolerance assessment (drought, temperature, salinity)

    • Root system architecture analysis

    • Yield component measurements under optimal and stress conditions

Leveraging Natural Variation:
Research in Arabidopsis has demonstrated significant natural variation in root system architecture among different accessions . Similarly, exploiting natural variation in CBSCBSPB4 orthologs within crop germplasm collections could identify beneficial alleles for breeding programs.

Case Study Framework:
Arabidopsis research has proven valuable for translational applications . A systematic approach for CBSCBSPB4 translation might include:

  • Proof of Concept in Arabidopsis:

    • Establish clear phenotypic effects of CBSCBSPB4 modification

    • Characterize molecular mechanisms (e.g., thioredoxin regulation )

  • Initial Crop Validation in Model Crop:

    • Test functional conservation in a genetically tractable crop (e.g., rice)

    • Verify phenotypic effects translate to a monocot system

  • Target Crop Application:

    • Apply validated strategies to crops of agricultural importance

    • Adapt methodologies based on crop-specific considerations

As highlighted in recent literature, Arabidopsis research can "inspire the next generation of plant biologists to continue leveraging Arabidopsis as a robust and convenient experimental system to address fundamental and applied questions in biology" . For CBSCBSPB4 specifically, its potential role in stress responses and redox regulation makes it a promising candidate for improving crop resilience to environmental challenges.

What ethical and regulatory considerations should researchers address when applying CBSCBSPB4 research to agricultural biotechnology?

When applying CBSCBSPB4 research to agricultural biotechnology, researchers must navigate several ethical and regulatory considerations:

Regulatory Framework Navigation:

  • Gene Editing Classification: Determine whether CBSCBSPB4 modifications would be classified differently under various regulatory frameworks:

    • Point mutations vs. transgenic approaches

    • Cisgenics (using genes from sexually compatible species) vs. transgenics

    • Product-based vs. process-based regulatory approaches in different jurisdictions

  • Safety Assessment Requirements:

    • Molecular characterization of modifications

    • Compositional analysis of modified crops

    • Allergenic and toxicological evaluations

    • Environmental risk assessment

  • Global Regulatory Variation:

    • Account for differences between U.S., EU, and other regulatory frameworks

    • Consider implications for international trade of developed crops

Ethical Considerations:

  • Environmental Impact Assessment:

    • Potential effects on non-target organisms

    • Gene flow considerations

    • Biodiversity impacts

    • Sustainability analysis

  • Socioeconomic Impacts:

    • Access and benefit-sharing for developed technologies

    • Implications for smallholder farmers

    • Economic resilience of agricultural systems

  • Transparency and Public Engagement:

    • Clear communication about research goals and methods

    • Stakeholder involvement in decision-making

    • Addressing public concerns about plant biotechnology

Intellectual Property Considerations:

  • Patent Landscape Analysis:

    • Identify existing patents covering CBS domain-containing proteins

    • Freedom-to-operate assessment

    • Consider open-source alternatives

  • Licensing Strategies:

    • Humanitarian use licensing for developing world applications

    • Public-private partnerships to maximize impact

Responsible Innovation Framework:

  • Anticipatory Governance:

    • Proactively identify potential issues

    • Engage with regulatory bodies early in the research process

  • Adaptive Management:

    • Monitor deployed technologies

    • Adjust approaches based on observed outcomes

The Arabidopsis research community has emphasized that "the power of Arabidopsis-inspired biotechnologies and foundational discoveries will continue to fuel the development of resilient, high-yielding, nutritious plants for the betterment of plant and animal health and greater environmental sustainability" . This vision aligns with responsible innovation principles but requires careful navigation of the complex regulatory and ethical landscape surrounding agricultural biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.