Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB5 (CBSCBSPB5)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

CBSCBSPB5 is a specific protein encoded by the CBSCBSPB5 gene (At5g50640, also known as MFB16.3) in Arabidopsis thaliana, commonly referred to as mouse-ear cress . This protein belongs to the broader family of CBS domain-containing proteins (CDCPs), which are characterized by the presence of one or more pairs of CBS domains. The Arabidopsis genome encodes a total of 34 CDCPs, each containing one or two pairs of CBS domains that are generally closely associated with other functional protein domains .

CBS domains, named after cystathionine beta-synthase where they were first identified, are small structural motifs of approximately 60 amino acids that form an antiparallel β-sheet flanked by helices on one side. These domains typically appear as tandem repeats forming a CBS pair or what is known as the Bateman domain . The structure and arrangement of these domains play crucial roles in the protein's function and regulatory capabilities.

CBSCBSPB5 contains a CBS domain paired with a PB5 domain, distinguishing it from some other members of the CBSX subfamily that contain only stand-alone pairs of CBS domains. This combination of domains likely contributes to its specific functional properties and regulatory mechanisms in plant cellular processes.

Tertiary and Quaternary Structure

While the specific three-dimensional structure of CBSCBSPB5 has not been directly reported in the provided research materials, insights can be drawn from studies on related CBS domain-containing proteins. Generally, CBS domain-containing proteins form homodimers with their CBS pairs arranged in an anti-parallel (head-to-tail) orientation .

The crystal structures of related Arabidopsis CBS proteins like CBSX1 and CBSX2 have shown that these proteins form anti-parallel homodimers exhibiting similar quaternary structures . By extension, CBSCBSPB5 likely adopts a similar dimeric arrangement, which would be important for its function in binding regulatory molecules and interacting with partner proteins.

Functional Domains

The CBS domains in CBSCBSPB5 and other related proteins are generally involved in the binding of regulatory adenosyl ligands such as AMP, ATP, or S-adenosylmethionine . This binding can modulate the activity of associated functional domains or interacting proteins. The specific combination of CBS domains with the PB5 domain in CBSCBSPB5 suggests a unique regulatory function that distinguishes it from other members of the CBS protein family.

Physiological Roles

While the specific physiological roles of CBSCBSPB5 remain to be fully characterized, research on related CBS domain-containing proteins provides valuable insights. Studies have shown that CBS domain-containing proteins in plants can play roles in:

  1. Regulating thioredoxin activities, which are involved in redox-based regulation of numerous enzymatic activities

  2. Improving tolerance to oxidative stress, salinity, and heavy metal toxicity

  3. Enhancing performance under low nitrogen conditions

For instance, a CBS domain-containing protein called GmCBS21 has been identified as a candidate gene for nitrogen use efficiency (NUE) and was found to enhance abiotic stress tolerance and improve performance of transgenic Arabidopsis thaliana under low nitrogen conditions . These findings suggest potential roles for CBSCBSPB5 in stress responses and metabolic regulation in plants.

Post-Translational Modifications

Post-translational modifications play crucial roles in regulating protein function, localization, and interactions. According to the iPTMnet database, CBSCBSPB5 (UniProt ID: P0DH79) undergoes phosphorylation at multiple serine residues as detailed in the following table :

SitePTM TypeSourcePMIDs
S11Phosphorylationp3DB20466843, 19376835, 18463617
S13Phosphorylationp3DB20466843, 19376835, 18463617
S15Phosphorylationp3DB19376835
S18Phosphorylationp3DB, UniProt20466843, 19376835, 18463617
S49Phosphorylationp3DB20466843, 19376835, 18463617
S50Phosphorylationp3DB20466843, 19376835, 18463617
S52Phosphorylationp3DB20466843, 19376835, 18463617
S54Phosphorylationp3DB19376835
S407Phosphorylationp3DB20466843, 18463617

These phosphorylation sites are predominantly clustered in the N-terminal region of the protein (S11-S54), with an additional site (S407) located closer to the C-terminus . The concentration of phosphorylation sites in the N-terminal region suggests this may be a regulatory region important for protein function, localization, or interactions. The identification of these phosphorylation sites across multiple studies underscores their significance and suggests that CBSCBSPB5 may be dynamically regulated through phosphorylation events, potentially in response to different cellular conditions or environmental stimuli.

Expression and Purification

Recombinant CBSCBSPB5 protein is produced using Escherichia coli expression systems. According to the product information, the recombinant protein corresponds to the full-length CBSCBSPB5 (amino acids 1-548) fused to an N-terminal His tag . The protein is expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE .

Gene Structure and Evolution

Research indicates that in G. raimondii, a cotton species with a D genome, the CBSCBSPB5 homolog is the member of the CBS domain-containing protein family most interrupted by introns . This suggests that the gene structure of CBSCBSPB5 and its homologs may have undergone significant evolutionary changes across different plant species.

CBS domain-containing proteins are widely distributed across various organisms, from bacteria to plants and animals, indicating their ancient evolutionary origin and fundamental importance in cellular processes . The diversification of these proteins in plants, with 34 CDCPs in Arabidopsis and 59 in rice (Oryza sativa), suggests they may have evolved specialized functions in different plant lineages .

Subfamily Relationships

The CBSX subfamily, to which CBSCBSPB5 is related, appears to have undergone further diversification in terms of subcellular localization and function. For instance, CBSX1 and CBSX2 are targeted to plastids, CBSX3 to mitochondria, CBSX4 is predicted to be cytosolic, and CBSX5 and CBSX6 are expected to be located in the endoplasmic reticulum . This diversification suggests specialized functions for different members of the CBS protein family in various cellular compartments.

Recent phylogenetic analysis and reclassification efforts have led to better understanding of the relationships between different CBS domain-containing proteins in plants . These studies provide a framework for understanding the evolutionary relationships and potential functional divergence of CBSCBSPB5 and related proteins.

Current Research Applications

  1. Structural studies (e.g., X-ray crystallography, NMR)

  2. Functional characterization (e.g., enzymatic assays, binding studies)

  3. Protein-protein interaction studies (e.g., pull-down assays, co-immunoprecipitation)

  4. Generation of antibodies for immunological detection

  5. In vitro reconstitution of biological processes

Future Research Directions

Future research on CBSCBSPB5 could focus on several promising areas:

  1. Detailed structural analysis to understand how its CBS domains contribute to its function

  2. Identification of interacting partners and regulatory networks

  3. Characterization of the functional significance of the multiple phosphorylation sites

  4. Investigation of its role in plant stress responses and metabolic regulation

  5. Comparative analysis across different plant species to understand its evolutionary conservation and diversification

Such studies would not only enhance our understanding of CBSCBSPB5 specifically but also contribute to the broader knowledge of CBS domain-containing proteins and their diverse roles in plant biology, potentially leading to applications in crop improvement and stress tolerance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requirements. Please indicate your preference when placing your order, and we will fulfill your demand.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type selection occurs during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
CBSCBSPB5; At5g50640; MFB16.3; CBS domain-containing protein CBSCBSPB5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CBSCBSPB5
Target Protein Sequence
MANQGGPSRKSLSFSGHSFQGRKKASENEGGGGGGSDLLPRRSLTSSRSSISLSGERSGE RTVKRLRLCKALTVPDSTTLFEACRRMAARRVDALLLTDSNALLCGILTDRDIATKVIAK QLNLEETPVSKVMTKNPVFVLSDTIAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLY DAIARMERSVEKGKAIAAAVEGVEKNWGTSIAGPNTFMETLRERIFKPSLSTIIPENTKV LKVGLDETVLGVTMKMVEYQSSAAMVMVENKLVGILTSKDILMRVISQNLPQETTTVEKV MTPNPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAG INNETANSMMQKFWDSAMALSPNEDGDETRSEEESMKLSSEIEVTKSFSYPNTFAFKLQD KKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLGAAV EHAKSIGWKGLKLHLDYTEERGHRRGLSSEDMDYDQSNSWAAAYKTVAAGAALAAGLGVL VYLKRNSN
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G50530

UniGene: At.29723

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the CBSCBSPB5 protein and where is it found?

CBSCBSPB5 is a CBS domain-containing protein that is a translation product of the CBSCBSPB5 gene in Arabidopsis thaliana. It is officially identified as UniProt AC/ID: P0DH79/Y5064_ARATH . The protein contains multiple CBS domains which are important regulatory modules found in proteins across diverse organisms. In Arabidopsis, the CBSCBSPB5 gene is also known by the ordered locus name At5g50640 and ORF name MFB16.3 . This protein is part of a larger family of CBS domain-containing proteins that have been implicated in various cellular functions, particularly in response to environmental stresses.

What is the molecular structure of CBSCBSPB5?

CBSCBSPB5 is a full-length protein consisting of 548 amino acids . The protein contains multiple CBS domains, which are evolutionarily conserved motifs of approximately 60 amino acids that occur in various proteins in all kingdoms of life. The protein has been characterized with several phosphorylation sites, which are critical for its regulation and function. Specifically, phosphorylation has been identified at multiple serine residues: S11, S13, S15, S18, S49, S50, S52, S54, and S407 . These phosphorylation sites suggest complex post-translational regulation of this protein's activity.

How does the gene structure of CBSCBSPB5 compare to other CBS domain-containing proteins?

The CBSCBSPB5 gene is notable for its complex intron-exon structure. While some CBS domain-containing proteins in cotton species (Gossypium) are intronless, CBSCBSPB5 is characterized by multiple intron disruptions . In G. raimondii (a cotton species with D genome), the CBSCBSPB5 ortholog was identified as being highly interrupted by introns . This complex gene structure is consistent with findings in other plant species and suggests evolutionary conservation of the gene architecture despite divergence of species. The presence of introns may contribute to the regulation of gene expression, though their exact role requires further investigation.

What is the functional significance of CBS domains in CBSCBSPB5?

CBS domains are known to function as sensors of cellular energy status by binding adenosine-containing ligands such as AMP, ATP, or S-adenosylmethionine. In CBSCBSPB5, these domains likely serve as regulatory modules that respond to changes in energy levels or stress conditions.

Research suggests that CBS domain-containing proteins play crucial roles in plant stress responses. Previous investigations have demonstrated that overexpression of CBS domain-containing proteins in rice improved tolerance to oxidative stress, salinity, and heavy metal toxicity in transgenic tobacco . Similarly, expression of a CBS domain-containing protein GmCBS21 (a candidate gene for nitrogen use efficiency) enhanced abiotic stress tolerance and improved performance of transgenic Arabidopsis thaliana under low nitrogen conditions .

The functional versatility of CBS domains is likely due to their ability to modulate protein activity through conformational changes upon ligand binding, making them important switches in cellular signaling networks responding to environmental stresses.

How does phosphorylation affect CBSCBSPB5 function?

CBSCBSPB5 has been identified with multiple phosphorylation sites, with particularly strong evidence (score2) for phosphorylation at S18 according to both p3DB and UniProt databases, while other serine residues (S11, S13, S15, S49, S50, S52, S54, and S407) show evidence of phosphorylation with score1 . The table below summarizes the phosphorylation data:

SitePTM TypeEvidence ScoreSourcePMID
S11Phosphorylationscore1p3DB20466843, 19376835, 18463617
S13Phosphorylationscore1p3DB20466843, 19376835, 18463617
S15Phosphorylationscore1p3DB19376835
S18Phosphorylationscore2p3DB, UniProt20466843, 19376835, 18463617
S49Phosphorylationscore1p3DB20466843, 19376835, 18463617
S50Phosphorylationscore1p3DB20466843, 19376835, 18463617
S52Phosphorylationscore1p3DB20466843, 19376835, 18463617
S54Phosphorylationscore1p3DB19376835
S407Phosphorylationscore1p3DB20466843, 18463617

These phosphorylation events likely play important roles in regulating protein-protein interactions, subcellular localization, or enzymatic activity of CBSCBSPB5 in response to environmental stimuli. The clustering of phosphorylation sites (especially S11-S18 and S49-S54) suggests these regions may be regulatory hotspots that undergo coordinated modifications to fine-tune protein function under different conditions.

What genomic approaches are being used to study CBS domain proteins like CBSCBSPB5?

Research on CBS domain-containing proteins has benefited from advances in genomic technologies. In Arabidopsis research, computational approaches are increasingly important, as noted in the 4th Multinational Arabidopsis Steering Committee Roadmap . These approaches include:

  • Phylogenetic analysis to understand evolutionary relationships between CBS domain proteins across species

  • Chromosome mapping to identify genomic positions and potential regulatory regions

  • Intron-exon structure analysis to characterize gene architecture

  • ds/dn analysis to assess selective pressure on protein-coding regions

Additionally, researchers are leveraging AI and large language models to understand the "grammar" of genomic regulation , which could provide insights into how CBS domain-containing genes like CBSCBSPB5 are regulated at the transcriptional level. Single-cell approaches are also being applied to study cell-cell, organ-organ, and plant-environment communication/signaling, which may reveal context-specific functions of CBSCBSPB5 .

How can recombinant CBSCBSPB5 protein be produced for experimental studies?

Recombinant CBSCBSPB5 production typically involves heterologous expression in bacterial systems like E. coli. Based on available information, a methodological approach would include:

  • Cloning Strategy: The full-length cDNA of CBSCBSPB5 (1-548 amino acids) is cloned into an expression vector with a His-tag for purification purposes .

  • Expression System: E. coli is commonly used as the host organism for expression . Selection of an appropriate E. coli strain (e.g., BL21(DE3), Rosetta, or Arctic Express) should be based on codon usage optimization and protein solubility considerations.

  • Induction Conditions: Expression is typically induced with IPTG, with optimization of concentration (0.1-1 mM), temperature (16-37°C), and duration (3-18 hours) to maximize protein yield while maintaining solubility.

  • Purification: His-tagged CBSCBSPB5 can be purified using nickel affinity chromatography, followed by size exclusion chromatography to enhance purity. Buffer conditions should be optimized to maintain protein stability and function.

  • Verification: SDS-PAGE, Western blotting, and mass spectrometry can confirm identity and purity, while circular dichroism or thermal shift assays can assess proper folding.

For functional studies, it's essential to verify that the recombinant protein maintains its native conformation and activity, particularly regarding its ability to bind adenosine-containing ligands and undergo phosphorylation.

What are effective approaches for studying CBSCBSPB5 function in planta?

To investigate CBSCBSPB5 function in Arabidopsis thaliana, several complementary approaches can be employed:

  • Genetic Approaches:

    • T-DNA insertion mutants analysis to assess loss-of-function phenotypes

    • CRISPR-Cas9 gene editing for precise modification of specific domains or phosphorylation sites

    • Overexpression studies using constitutive (35S) or inducible promoters

    • Complementation assays with wild-type or mutated versions of CBSCBSPB5

  • Phenotypic Characterization:

    • Stress tolerance assays (oxidative, salt, heavy metal, nutrient deprivation)

    • Growth and development parameters under normal and stress conditions

    • Metabolite profiling to identify changes in energy-related compounds

  • Molecular Analysis:

    • RNA-seq to identify transcriptional changes in mutants or overexpression lines

    • Protein-protein interaction studies using yeast two-hybrid, co-immunoprecipitation, or proximity labeling approaches

    • Phosphoproteomic analysis to identify in vivo phosphorylation states under different conditions

Building on previous findings with other CBS domain proteins, researchers should particularly focus on assessing nitrogen use efficiency and abiotic stress tolerance phenotypes, as these have been implicated in studies of related proteins like GmCBS21 .

How can researchers analyze CBSCBSPB5 phosphorylation dynamics in vivo?

Studying phosphorylation dynamics of CBSCBSPB5 in vivo requires specialized approaches:

  • Phospho-specific Antibodies: Generation of antibodies that specifically recognize phosphorylated forms of CBSCBSPB5 at sites like S18 (which has the strongest evidence for phosphorylation ) would allow for detection of phosphorylation status under different conditions.

  • Mass Spectrometry-based Approaches:

    • Targeted phosphoproteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

    • Phosphopeptide enrichment using titanium dioxide (TiO₂) or immobilized metal affinity chromatography (IMAC)

    • Quantitative analysis using stable isotope labeling (SILAC, TMT, or iTRAQ)

  • In vivo Imaging:

    • Generation of fluorescent protein fusions with phospho-binding domains

    • FRET-based sensors to monitor phosphorylation status in real-time

  • Genetic Approaches:

    • Phosphomimetic mutations (S→D or S→E) and phospho-null mutations (S→A) to assess the functional impact of phosphorylation at specific sites

    • Expression of these variants in cbscbspb5 null mutants to assess complementation

These methodologies would help researchers determine when and where CBSCBSPB5 phosphorylation occurs, which kinases are responsible, and how these modifications affect protein function in response to various environmental stimuli or developmental cues.

How should researchers interpret conflicting data on CBSCBSPB5 function across different experimental systems?

When faced with conflicting data on CBSCBSPB5 function, researchers should consider:

  • Context-dependent Functions: CBS domain-containing proteins often have diverse roles depending on cellular context. Differences between in vitro and in vivo results, or between different model systems, may reflect genuine biological complexity rather than experimental artifacts.

  • Methodological Differences: Variations in experimental conditions, protein expression levels, post-translational modifications, or interaction partners can significantly impact functional readouts. Detailed documentation and comparison of methodologies is essential.

  • Systematic Validation Approach:

    • Reproduce key experiments using standardized protocols across different systems

    • Validate findings using multiple independent techniques

    • Consider dose-dependent and temporal aspects of protein function

  • Evolutionary Conservation Analysis: Comparing functions of orthologs across different plant species can help distinguish core conserved functions from species-specific adaptations. The significant conservation of "disease genes" between Arabidopsis and humans (approximately 70% orthology) suggests fundamental cellular functions are often preserved despite divergent evolutionary paths.

  • Integration with Systems Biology Approaches: Network analysis incorporating transcriptomic, proteomic, and metabolomic data can help contextualize seemingly contradictory findings by placing CBSCBSPB5 within broader biological pathways and processes.

What bioinformatic resources are most valuable for analyzing CBSCBSPB5 and related proteins?

Several bioinformatic resources are particularly valuable for researchers studying CBSCBSPB5:

  • Protein Information Databases:

    • UniProt (P0DH79): Provides comprehensive protein information including sequence, domains, and post-translational modifications

    • iPTMnet: Offers detailed information on post-translational modifications, particularly phosphorylation sites

    • PRO (PR:P0DH79): Protein Ontology resource with standardized protein definitions

  • Functional Analysis Tools:

    • AraGWAS Catalog: Resource for genome-wide association studies in Arabidopsis

    • AlphaFold2: For structural predictions of CBSCBSPB5 and its domains

    • CBS Domain Prediction Servers: For detailed analysis of the functional motifs

  • Comparative Genomics Resources:

    • The 250,000 SNP-chip dataset for over 1,000 wild Arabidopsis strains: Useful for natural variation studies

    • Cross-species comparison databases to identify orthologs in crop species

  • Expression Databases:

    • The Arabidopsis Information Resource (TAIR)

    • BAR (Bio-Analytic Resource for Plant Biology)

    • Genevestigator: For expression pattern analysis across tissues and conditions

As noted in recent Arabidopsis research reviews, computational approaches and artificial intelligence are becoming increasingly important for understanding gene regulatory networks , making tools that can integrate diverse data types particularly valuable for comprehensive analysis of CBSCBSPB5 function.

How can researchers determine if CBSCBSPB5 has translational potential for crop improvement?

Evaluating the translational potential of CBSCBSPB5 research for crop improvement requires systematic assessment:

  • Ortholog Identification and Characterization:

    • Identify CBSCBSPB5 orthologs in target crop species using comparative genomics

    • Analyze conservation of key domains, phosphorylation sites, and regulatory elements

    • Assess expression patterns in stress conditions relevant to agricultural challenges

  • Functional Validation in Crop Models:

    • Generate transgenic crop plants overexpressing or silencing CBSCBSPB5 orthologs

    • Evaluate phenotypic effects under controlled stress conditions and field trials

    • Validate molecular mechanisms through parallel studies in Arabidopsis and crop systems

  • Systematic Literature Analysis:

    • Previous research indicates that CBS domain-containing proteins can improve tolerance to oxidative stress, salinity, and heavy metal toxicity when overexpressed

    • The improvement of nitrogen use efficiency observed with GmCBS21 suggests CBSCBSPB5 might similarly impact nutrient utilization

  • Consideration of Broader Agricultural Context:

    • Evaluate potential trade-offs between stress tolerance and yield

    • Assess environmental and regulatory implications of modifying CBS domain-containing proteins

    • Consider stacking with other beneficial traits for comprehensive crop improvement

The successful translation of Arabidopsis research to crop improvement has numerous precedents , making CBSCBSPB5 a plausible candidate for similar translational efforts, particularly for improving stress tolerance and resource use efficiency in crops.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.