Recombinant Arabidopsis thaliana CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 (PIS1)

Shipped with Ice Packs
In Stock

Description

Introduction to CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1

CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1, commonly abbreviated as PIS1, is an essential enzyme in Arabidopsis thaliana that catalyzes the formation of phosphatidylinositol from CDP-diacylglycerol and myo-inositol. This enzyme is critical for the biosynthesis of phosphatidylinositol, which serves as a precursor for various phosphoinositides involved in membrane trafficking, signal transduction, and cellular regulation . The gene encoding PIS1 is located on chromosome 1 of Arabidopsis thaliana and is also known by several alternative names including AtPIS1, PI synthase 1, and PtdIns synthase 1 . The recombinant form of this enzyme has been extensively studied to understand its biochemical properties and potential applications in both basic research and biotechnology.

In the context of plant cellular biology, PIS1 plays a crucial role in maintaining membrane integrity and function. The enzyme is integral to the phospholipid biosynthetic pathway, which is essential for normal cellular growth and development in plants. Phosphatidylinositol and its phosphorylated derivatives are vital components of cellular membranes and serve as important signaling molecules in response to various environmental stimuli and stresses . The study of recombinant PIS1 provides valuable insights into the molecular mechanisms underlying these important cellular processes.

Gene and Protein Classification

The PIS1 gene (At1g68000) in Arabidopsis thaliana encodes the CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 protein. The gene is also referred to by alternative designations including T23K23.15 in the Arabidopsis genome annotation . The protein product is classified under the UniProt ID Q8LBA6 and belongs to the family of phosphatidylinositol synthases. These enzymes are characterized by their ability to catalyze the transfer of phosphatidyl groups from CDP-diacylglycerol to inositol, forming phosphatidylinositol and CMP (cytidine monophosphate) .

Recombinant Expression and Purification

For research purposes, the recombinant form of PIS1 is typically expressed with an N-terminal His-tag to facilitate purification and subsequent analyses. The typical expression system involves E. coli as the host organism, which is particularly useful because E. coli naturally lacks phosphatidylinositol, providing a clean background for studying the enzyme's activity . The recombinant protein is expressed as a full-length protein (1-227 amino acids) and is typically supplied in lyophilized powder form with greater than 90% purity as determined by SDS-PAGE .

Physical and Chemical Properties

Table 1: Physical and Chemical Properties of Recombinant PIS1

PropertySpecification
Length227 amino acids (full length)
TagN-terminal His-tag
Expression SystemE. coli
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL); 5-50% glycerol recommended for long-term storage

The recombinant protein's stability is significantly affected by storage conditions. Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for no more than one week . For long-term storage, it is recommended to add glycerol (5-50% final concentration) and store at -20°C/-80°C to maintain the protein's enzymatic activity.

Catalytic Activities

Studies with recombinant Arabidopsis thaliana PIS1 expressed in E. coli have revealed important insights into its enzymatic properties. The enzyme catalyzes two main reactions:

  1. De novo synthesis of phosphatidylinositol: The primary function of PIS1 is to catalyze the formation of phosphatidylinositol (PtdIns) from CDP-diacylglycerol and myo-inositol. This reaction is essential for maintaining the phospholipid composition of cellular membranes .

  2. Inositol head group exchange: Interestingly, the enzyme can also catalyze the exchange of the inositol head group of existing phosphatidylinositol molecules for another inositol molecule. This CDP-diacylglycerol-independent exchange reaction can occur using either endogenous PtdIns molecular species or PtdIns molecular species from external sources (such as soybean) added to the reaction mixture .

Cofactor Requirements and Kinetics

The enzymatic activities of recombinant PIS1 have specific cofactor requirements. All PtdIns metabolizing activities require free manganese ions (Mn²⁺) for optimal function . The presence of CMP (cytidine monophosphate) significantly affects the enzyme's activity:

  1. The inositol head group exchange reaction can occur in the absence of CMP but is greatly enhanced in the presence of low concentrations (approximately 4 μM) of CMP .

  2. At higher CMP concentrations, PIS1 can catalyze the removal of the polar head group, essentially reversing the synthesis reaction .

Additionally, EDTA (ethylenediaminetetraacetic acid) has been found to enhance the enzyme's activity in the presence of low Mn²⁺ concentrations, suggesting a complex interplay between metal ions and the enzyme's catalytic mechanism .

Substrate Specificity

Recombinant PIS1 exhibits flexibility in terms of substrate utilization. The enzyme can use both endogenously produced PtdIns molecular species and exogenously added PtdIns (such as from soybean) for the inositol head group exchange reaction . This flexibility in substrate usage suggests that the enzyme has evolved to accommodate variations in membrane phospholipid composition, which may be important for adapting to different environmental conditions or developmental stages in plants.

Structure-Function Studies

Recombinant PIS1 serves as a valuable tool for structure-function studies of phosphatidylinositol synthases. By expressing the enzyme in E. coli, which naturally lacks phosphatidylinositol, researchers can study the enzyme's activity in a simplified system without interference from endogenous phosphatidylinositol metabolism . This approach has enabled detailed characterization of the enzyme's catalytic mechanisms, substrate specificities, and cofactor requirements.

Membrane Biology Research

Given its role in phospholipid biosynthesis, recombinant PIS1 is an important tool for studying membrane biology in plants. Phosphatidylinositol and its derivatives are critical components of cellular membranes and play key roles in membrane trafficking, signal transduction, and responses to environmental stresses. By manipulating PIS1 activity, researchers can investigate how changes in phosphatidylinositol levels affect these processes, providing insights into the molecular mechanisms underlying plant development and stress responses.

Distinguishing PIS1 from Other Similarly Named Proteins

It is important to note that in the scientific literature, there exists some potential for confusion regarding the abbreviation "PIS1" in Arabidopsis thaliana research. While the focus of this article is specifically on CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 (phosphatidylinositol synthase 1), there is another distinct protein that has been referred to as "PIS1" in some contexts.

The ABCG37 transporter, which functions as an exporter of auxinic compounds in Arabidopsis, has been referred to as PIS1 in the context of the polar auxin transport inhibitor sensitive1 (pis1) mutation . This protein is unrelated to the phosphatidylinositol synthase discussed in this article, despite sharing the same abbreviation. The ABCG37/PIS1 transporter is involved in auxin transport and root development, while CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 (PIS1) is involved in phospholipid metabolism .

Similarly, another protein called PSS1 (a glycine-rich plasma membrane protein) has been identified in Arabidopsis, which should not be confused with PIS1 despite the similarity in abbreviation . PSS1 is an integral plasma membrane protein with a single membrane-spanning domain and is involved in nonhost resistance to pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PIS1; At1g68000; T23K23.15; CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1; Phosphatidylinositol synthase 1; AtPIS1; PI synthase 1; PtdIns synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PIS1
Target Protein Sequence
MAKKERPRPEKLSVYLYIPNIVGYMRVLLNCVAFAVCFSNKPLFSVLYFFSFCCDAVDGW VARRFNQVSTFGAVLDMVTDRVSTACLLVILSQIYRPSLVFLSLLALDIASHWLQMYSTF LAGKSSHKDVKDSTSWLFRLYYGNRIFMCYCCVSCEVLYIILLLIAKNQSENLLNVVVAT LTQISPLSFLLALTLFGWSMKQTINVIQMKTAADVCVLYDIEKQQKP
Uniprot No.

Target Background

Function
This enzyme catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reactions. It may thus act to reduce excessive cellular PtdIns content. The exchange activity is attributed to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.
Database Links

KEGG: ath:AT1G68000

STRING: 3702.AT1G68000.1

UniGene: At.24677

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in stems, flowers, shoots and roots. Present in epidermal tissues.

Q&A

What is the primary function of PIS1 in Arabidopsis thaliana?

PIS1 (CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1) catalyzes the biosynthesis of phosphatidylinositol from CDP-diacylglycerol and inositol. Beyond this biochemical function, PIS1 has been implicated in auxin transport regulation pathways. Research suggests that the PIS1 gene is specifically involved in the response pathway to naphtylphthalamic acid (NPA) and triiodobenzoic acid (TIBA), both of which are known auxin efflux inhibitors . This connection to auxin transport makes PIS1 potentially significant in various developmental processes and gravitropic responses.

Methodological approach for functional characterization:

  • Expression of recombinant PIS1 in heterologous systems (E. coli, yeast)

  • In vitro enzyme activity assays using purified protein with CDP-diacylglycerol and inositol substrates

  • Genetic complementation studies in pis1 mutant backgrounds

  • Analysis of phenotypic changes in response to auxin transport inhibitors

How is PIS1 gene expression regulated in Arabidopsis?

PIS1 expression patterns have been studied using both transcriptional and translational fusion reporters. While comprehensive expression data is still being developed, research approaches have revealed tissue-specific expression patterns that correlate with developmental processes requiring active membrane synthesis and remodeling.

Methodological approach to study expression:

  • Real-time quantitative PCR analysis of PIS1 transcripts across tissues and developmental stages

  • Generation of transgenic lines with PIS1 promoter::GUS or PIS1 promoter::GFP constructs

  • Immunolocalization studies using antibodies specific to PIS1

  • RNA-seq analysis to identify co-regulated genes and potential regulatory networks

What phenotypes are associated with PIS1 mutants in Arabidopsis?

Mutants in the PIS1 gene display several characteristic phenotypes related to auxin transport and responses. The pis1 mutation affects root curling in the presence of NPA and shows increased sensitivity to polar auxin transport inhibitors (NPA and TIBA) for multiple phenotypes including:

  • Altered root gravitropism and phototropism

  • Abnormal root curling patterns

  • Reduced root elongation

  • Stunted seedling growth

Methodological approach for phenotypic analysis:

  • Root gravitropic assays using agar plates rotated 90° from vertical

  • Root growth measurements on media containing varying concentrations of auxin transport inhibitors

  • Microscopic analysis of cell elongation and division patterns

  • Auxin response visualization using DR5::GUS reporter lines in wild-type versus pis1 backgrounds

What are the optimal conditions for expressing recombinant PIS1 protein?

Expression of functional recombinant PIS1 requires careful optimization due to the membrane-associated nature of this enzyme.

Methodological approach for recombinant expression:

  • Expression systems comparison:

Expression SystemAdvantagesDisadvantagesYield (mg/L culture)
E. coli (BL21)Cost-effective, rapidPotential misfolding0.5-2.0
E. coli (C41/C43)Better for membrane proteinsLower yields0.3-1.5
Yeast (P. pastoris)Post-translational modificationsLonger production time2.0-5.0
Insect cellsNative-like foldingExpensive, complex3.0-8.0
  • Optimization parameters:

    • Induction temperature: 16-18°C typically yields more soluble protein

    • Expression time: 16-24 hours post-induction

    • Detergent selection for membrane extraction (CHAPS, DDM, or Triton X-100)

    • Addition of specific phospholipids during purification to maintain stability

  • Purification strategy:

    • Initial capture using affinity chromatography (His-tag or GST-tag)

    • Secondary purification via ion exchange chromatography

    • Final polishing using size exclusion chromatography

How can researchers investigate the relationship between PIS1 and auxin transport mechanisms?

Understanding the molecular connection between PIS1 and auxin transport requires multidisciplinary approaches combining genetics, biochemistry, and cell biology.

Methodological approach:

  • Genetic interaction studies:

    • Generate double mutants with known auxin transport components (pin2, aux1, etc.)

    • Analyze epistatic relationships between pis1 and other mutants affecting auxin transport

  • Biochemical interaction assays:

    • Co-immunoprecipitation followed by mass spectrometry to identify PIS1-interacting proteins

    • Yeast two-hybrid or split-ubiquitin assays to test direct interactions with auxin transport proteins

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

  • Cell biology approaches:

    • Visualization of auxin gradients using auxin-responsive reporters in wild-type vs. pis1 backgrounds

    • Tracking labeled auxin transport dynamics using radioactive auxin transport assays

    • Membrane lipid profiling to identify changes in phosphatidylinositol content and distribution

What structural features of PIS1 are critical for its enzymatic function?

Understanding structure-function relationships is essential for elucidating PIS1's catalytic mechanism and regulation.

Methodological approach for structural studies:

  • Computational structure prediction:

    • Homology modeling based on related transferases

    • Molecular dynamics simulations to identify potential substrate binding sites

  • Experimental structure determination:

    • X-ray crystallography of purified PIS1 (challenging for membrane proteins)

    • Cryo-electron microscopy for membrane-associated complexes

    • NMR studies of specific domains

  • Mutagenesis approach:

    • Site-directed mutagenesis of predicted catalytic residues

    • Creation of chimeric proteins with related transferases

    • Truncation analysis to identify minimum functional domains

  • Activity correlation:

    • In vitro enzyme assays with purified wild-type and mutant proteins

    • Complementation studies in pis1 mutant backgrounds

How does phospholipid composition change in pis1 mutants?

Comprehensive lipid profiling can reveal the impact of PIS1 disruption on cellular phospholipid homeostasis.

Methodological approach for lipidomic analysis:

  • Extraction protocols:

    • Modified Bligh-Dyer method for total lipid extraction

    • Solid-phase extraction for phospholipid class separation

  • Analytical techniques:

    • Liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS)

    • Thin-layer chromatography for rapid profiling

    • 31P-NMR spectroscopy for phospholipid class quantification

  • Data analysis:

    • Multivariate statistical methods (PCA, PLS-DA) to identify significant changes

    • Pathway enrichment analysis to identify affected metabolic networks

Example data table from lipidomic analysis:

Phospholipid ClassWild-type (mol%)pis1 Mutant (mol%)Fold Changep-value
Phosphatidylinositol12.3 ± 1.23.5 ± 0.8-3.51<0.001
Phosphatidylcholine42.6 ± 2.548.1 ± 3.1+1.130.042
Phosphatidylethanolamine29.1 ± 1.933.4 ± 2.3+1.150.038
Phosphatidylserine8.2 ± 0.77.9 ± 0.9-1.040.652
Phosphatidic acid3.5 ± 0.45.8 ± 0.6+1.660.003

How can researchers develop specific inhibitors of PIS1 for functional studies?

Developing specific inhibitors of PIS1 can provide valuable tools for studying its function without genetic manipulation.

Methodological approach for inhibitor development:

  • Initial screening approaches:

    • In silico docking studies with virtual compound libraries

    • High-throughput biochemical assays with chemical libraries

    • Fragment-based screening

  • Lead optimization:

    • Structure-activity relationship (SAR) studies

    • Medicinal chemistry modifications to improve specificity

    • ADMET property optimization for in planta studies

  • Validation strategies:

    • In vitro enzymatic assays with purified PIS1

    • Cellular assays in Arabidopsis cell cultures

    • Whole-plant assays examining phenocopy of pis1 mutants

    • Binding studies (isothermal titration calorimetry, surface plasmon resonance)

What are the best approaches for studying PIS1 involvement in stress responses?

PIS1 and phosphoinositide signaling have been implicated in various stress responses in plants.

Methodological approach:

  • Stress treatment design:

    • Standardized protocols for applying abiotic stressors (drought, salt, cold, heat)

    • Controlled pathogen infection protocols (bacterial, fungal pathogens)

    • Time-course analysis to capture early and late responses

  • Multi-omics approach:

    • Transcriptomics: RNA-seq of wild-type vs. pis1 mutants under stress conditions

    • Proteomics: Quantitative proteome analysis focusing on membrane proteins

    • Metabolomics: Targeted and untargeted metabolite profiling

    • Lipidomics: Phosphoinositide profiling during stress responses

  • Phenotypic characterization:

    • Physiological measurements (photosynthetic efficiency, stomatal conductance)

    • Biochemical measurements (ROS production, antioxidant enzyme activity)

    • Growth measurements under stress conditions

How can CRISPR-Cas9 technology be optimized for PIS1 editing?

CRISPR-Cas9 gene editing offers powerful approaches for studying PIS1 function through precise genetic modifications.

Methodological approach:

  • Guide RNA design considerations:

    • Target specific functional domains based on structural predictions

    • Minimize off-target effects through careful guide selection

    • Design strategies for domain-specific mutations versus complete knockouts

  • Delivery methods comparison:

Delivery MethodEfficiencyAdvantagesLimitations
Agrobacterium-mediated1-5%Well-established, stableTime-consuming
Floral dip0.5-1%Simple, no tissue cultureLow efficiency
Protoplast transfection10-30%Higher efficiencyRequires regeneration
Particle bombardment1-10%Works for recalcitrant tissuesExpensive equipment
  • Validation strategies:

    • Targeted sequencing of edited regions

    • Whole-genome sequencing to identify off-target effects

    • Transcript analysis to verify expression changes

    • Protein analysis to confirm functional impacts

What considerations are important when interpreting contradictory data from PIS1 studies?

Researchers often encounter contradictory results when studying complex systems like phospholipid metabolism.

Methodological approach for resolving contradictions:

  • Systematic variation analysis:

    • Genetic background differences (ecotype effects)

    • Growth condition variations (light, temperature, media composition)

    • Developmental stage differences

    • Tissue-specific effects

  • Technical approach comparison:

    • Assay sensitivity and specificity evaluation

    • Standardized protocols development

    • Independent validation using complementary methods

    • Statistical power analysis to ensure adequate sample sizes

  • Collaborative approaches:

    • Multi-laboratory validation studies

    • Data sharing and meta-analysis

    • Community-established standards for PIS1 research

How can PIS1 function be integrated into broader signaling networks?

Understanding PIS1 in the context of broader cellular signaling requires integrative approaches.

Methodological approach:

  • Network reconstruction:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Protein-protein interaction mapping

    • Genetic interaction screens

    • Phosphoinositide-binding protein identification

  • Computational modeling:

    • Kinetic models of phosphoinositide metabolism

    • Agent-based models of auxin transport

    • Machine learning approaches to identify regulatory patterns

  • Validation experiments:

    • Targeted perturbation of network nodes

    • Dynamic measurement of multiple system components

    • Spatiotemporal imaging of phosphoinositide signaling

What are the evolutionary implications of PIS1 conservation across plant species?

Comparative genomics can reveal important evolutionary aspects of PIS1 function and regulation.

Methodological approach:

  • Phylogenetic analysis:

    • Sequence alignment of PIS1 homologs across diverse plant species

    • Identification of conserved domains and regulatory elements

    • Selection pressure analysis (dN/dS ratios)

  • Functional conservation testing:

    • Heterologous expression of PIS1 homologs in Arabidopsis pis1 mutants

    • Activity assays with recombinant PIS1 proteins from diverse species

    • Comparative phospholipid profiling across species

  • Regulatory evolution:

    • Promoter analysis across species

    • Expression pattern comparison in equivalent tissues

    • Co-evolution with interacting partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.