Recombinant Arabidopsis thaliana Cellulose synthase-like protein E1 (CSLE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CSLE1; At1g55850; F14J16.9; Cellulose synthase-like protein E1; AtCslE1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-729
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLE1
Target Protein Sequence
MVNKDDRIRPVHEADGEPLFETRRRTGRVIAYRFFSASVFVCICLIWFYRIGEIGDNRTV LDRLIWFVMFIVEIWFGLYWVVTQSSRWNPVWRFPFSDRLSRRYGSDLPRLDVFVCTADP VIEPPLLVVNTVLSVTALDYPPEKLAVYLSDDGGSELTFYALTEAAEFAKTWVPFCKKFN VEPTSPAAYLSSKANCLDSAAEEVAKLYREMAARIETAARLGRIPEEARVKYGDGFSQWD ADATRRNHGTILQVLVDGREGNTIAIPTLVYLSREKRPQHHHNFKAGAMNALLRVSSKIT CGKIILNLDCDMYANNSKSTRDALCILLDEKEGKEIAFVQFPQCFDNVTRNDLYGSMMRV GIDVEFLGLDGNGGPLYIGTGCFHRRDVICGRKYGEEEEEEESERIHENLEPEMIKALAS CTYEENTQWGKEMGVKYGCPVEDVITGLTIQCRGWKSAYLNPEKQAFLGVAPTNLHQMLV QQRRWSEGDFQIMLSKYSPVWYGKGKISLGLILGYCCYCLWAPSSLPVLIYSVLTSLCLF KGIPLFPKVSSSWFIPFGYVTVAATAYSLAEFLWCGGTFRGWWNEQRMWLYRRTSSFLFG FMDTIKKLLGVSESAFVITAKVAEEEAAERYKEEVMEFGVESPMFLVLGTLGMLNLFCFA AAVARLVSGDGGDLKTMGMQFVITGVLVVINWPLYKGMLLRQDKGKMPMSVTVKSVVLAL SACTCLAFL
Uniprot No.

Target Background

Function
A Golgi-localized beta-glycan synthase hypothesized to polymerize the backbones of non-cellulosic polysaccharides (hemicelluloses) in plant cell walls.
Database Links

KEGG: ath:AT1G55850

STRING: 3702.AT1G55850.1

UniGene: At.48310

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like E subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the relationship between CSLE1 and other cellulose synthase proteins in Arabidopsis thaliana?

CSLE1 belongs to the Cellulose Synthase-Like (CSL) family, which shares structural similarities with Cellulose Synthase A (CESA) proteins. While CESA proteins form cellulose synthase complexes (CSCs) that synthesize crystalline cellulose, CSLE1 is thought to be involved in the synthesis of non-cellulosic polysaccharides. The CSL family is divided into several subfamilies (CSLA through CSLH), each potentially responsible for synthesizing different hemicellulosic components of the plant cell wall.

Research methods to investigate this relationship typically include:

  • Phylogenetic analysis to establish evolutionary relationships

  • Comparative protein structure prediction

  • Expression pattern analysis across different tissues

  • Functional complementation studies

Based on studies of related proteins, CSLE1 likely contains transmembrane domains and a catalytic region with similarities to the CESA proteins that synthesize β-1,4-glucan chains .

How does CSLE1 expression differ from CSLD proteins in Arabidopsis tissues?

Unlike CSLD proteins that show high expression in specific tissues such as gametophores , CSLE1 exhibits a different expression pattern. To accurately characterize CSLE1 expression patterns, researchers typically employ:

  • Quantitative RT-PCR across various tissues and developmental stages

  • RNA-Seq analysis of transcript abundance

  • Promoter-reporter gene fusions (e.g., CSLE1pro:GUS) to visualize spatial expression patterns

  • Immunolocalization using CSLE1-specific antibodies

CSLD proteins (such as CSLD6) have been observed to express in protonemata where they move in the plasma membrane and localize to cell plates and cell tips , while CSLE1's specific localization pattern may differ and should be determined experimentally.

What expression systems are most effective for producing recombinant CSLE1?

For successfully expressing functional recombinant CSLE1, researchers should consider:

Bacterial expression systems:

  • E. coli strains like BL21(DE3) can be used with pET-based expression vectors, similar to approaches used for other plant proteins

  • Codon optimization is crucial as the optimal DNA sequence depends on the expression system and should be optimized together with the protein of interest

Eukaryotic expression systems:

  • Insect cell expression (Sf9, Hi5) may provide better post-translational modifications

  • Plant-based expression systems such as Nicotiana benthamiana using Agrobacterium-mediated transient expression

Expression optimization table:

Expression SystemAdvantagesDisadvantagesRecommended Tags
E. coliHigh yield, simple protocolLimited PTMs, inclusion bodiesN-terminal (MAS(H)6S) or C-terminal (SG(His)6)
Insect cellsBetter folding, some PTMsHigher cost, longer protocolN-terminal His or Strep tag
Plant systemsNative PTMs, proper foldingLower yield, complex protocolC-terminal His or GFP fusion

Codon optimization tools can improve translation rates by addressing limitations related to host cell codon usage, but researchers should note that this might potentially alter protein conformation and functionality .

What are the most effective purification strategies for recombinant CSLE1?

Purifying membrane-associated proteins like CSLE1 requires specialized approaches:

  • Affinity chromatography:

    • His-tag purification using Ni-NTA or TALON resins

    • Novel approaches like CytivaTM Protein SelectTM technology for proteins lacking traditional affinity partners

  • Membrane protein solubilization:

    • Detergent screening (DDM, LMNG, etc.) to identify optimal solubilization conditions

    • Nanodisc or liposome reconstitution for functional studies

  • Quality assessment:

    • Size exclusion chromatography to ensure homogeneity

    • Western blotting with anti-His antibodies

    • Mass spectrometry for identity confirmation

Remember that the choice of affinity tag placement (N- or C-terminal) can significantly impact protein folding and function. Both positions should be tested, as was done with other recombinant proteins where researchers generated constructs with "a N-terminal poly-His tag (MAS(H)6S) and another with a poly-His tag fused to the C-terminus (-end of VIM-SG(His)6)" .

How can I determine if CSLE1 is involved in cellulose biosynthesis?

To assess CSLE1's potential role in cellulose biosynthesis, consider these methodological approaches:

  • Genetic approaches:

    • Generate CSLE1 knockout/knockdown mutants using T-DNA insertion or CRISPR-Cas9

    • Analyze phenotypes for cell wall defects, similar to how "tip1 mutants exhibited stunted growth, a characteristic trait observed in mutants with cellulose deficiency"

  • Biochemical analysis:

    • Quantify crystalline cellulose content in wild-type vs. mutant tissues using the Updegraff method

    • Analyze cell wall composition changes (similar to how researchers found "a significant reduction in crystalline cellulose content in the leaves of the tip1 mutants compared to the wild type" )

  • In vitro activity assays:

    • Purify recombinant CSLE1 and test for β-1,4-glucan synthase activity

    • Analyze reaction products using enzymatic digestion and HPAEC-PAD

  • Complementation studies:

    • Express CSLE1 in cesa mutants to test for functional redundancy

What methods are most effective for studying CSLE1 localization and dynamics?

To study CSLE1 subcellular localization and dynamics, researchers can employ techniques similar to those used for studying CSLD6:

  • Live-cell imaging:

    • Create fluorescent protein fusions (CSLE1-GFP) for in vivo visualization

    • Use spinning disk or laser scanning confocal microscopy for high-resolution imaging

  • Dynamics analysis:

    • Perform kymograph analysis to track protein movement over time

    • Use particle tracking to quantify parameters like "velocity measurements" and "confinement ratio"

    • Compare movement patterns with those of CESA10, which has been shown to move in "significantly faster, shorter in duration and less linear" patterns than other cellulose synthases

  • Drug treatments:

    • Test cytoskeleton inhibitors (e.g., latrunculin B for actin, oryzalin for microtubules)

    • Evaluate cellulose synthesis inhibitors (e.g., isoxaben, DCB) to determine if they affect CSLE1 dynamics, unlike CSLD6 which showed movements "insensitive to the cellulose synthesis inhibitor"

  • Co-localization studies:

    • Perform dual-color imaging with markers for various cellular compartments

    • Compare localization patterns with CESA proteins to identify similarities and differences

What techniques are most suitable for identifying CSLE1 interaction partners?

To investigate CSLE1's protein interaction network, consider these approaches:

  • Immunoprecipitation and mass spectrometry:

    • Create tagged CSLE1 constructs for pull-down experiments

    • Follow approaches similar to those used with "CESA6 as the bait protein to explore the CSC and its interactors"

    • Analyze co-precipitated proteins using LC-MS/MS with parameters such as "Trypsin as the cleavage enzyme, precursor and fragment mass tolerances of 10 ppm and 0.6 Da respectively, and a maximum of 2 missed cleavages"

  • Membrane-based yeast two-hybrid system:

    • Employ the "split-ubiquitin membrane yeast two-hybrid assay" as described for studying TIP1 and CSC protein interactions

    • Clone "CSLE1 cDNA upstream of the C-terminal half of ubiquitin (Cub) and the synthetic transcription factor LexA-VP16 within the pBT3-SUC bait vector"

    • Use selective medium lacking "adenine, leucine, tryptophan, and histidine (-Ade/-Leu/-Trp/-His), with the inclusion of 5mM 3-amino-1,2,4-triazole to enhance stringency"

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent proteins between CSLE1 and potential interactors

    • Visualize reconstituted fluorescence when proteins interact in vivo

  • FRET/FLIM analysis:

    • Use fluorescently tagged proteins to detect interactions through energy transfer

How can I design experiments to investigate post-translational modifications of CSLE1?

Post-translational modifications (PTMs) likely influence CSLE1 function. To study these:

  • S-acylation analysis:

    • Apply biotin-switch or click chemistry approaches to detect S-acylation

    • Investigate potential interactions with PATs (Protein Acyltransferases) like TIP1, which has been shown to interact with CSC proteins and influence cellulose biosynthesis through S-acylation

  • Mass spectrometry for PTM mapping:

    • Purify CSLE1 and analyze using LC-MS/MS with search parameters including "Fixed modifications (carbamidomethyl cysteine) and variable modifications (oxidation of methionine and acetylation of the protein N-terminus)"

    • Set "protein and peptide groups to a maximum false discovery rate (FDR) of <0.01 as determined by the Percolator algorithm"

  • Mutagenesis of potential modification sites:

    • Create point mutations at predicted S-acylation sites

    • Assess effects on localization and function

  • Inhibitor studies:

    • Test the impact of PTM enzyme inhibitors on CSLE1 localization and function

    • Assess whether "S-acylation forms microdomains within the plasma membrane" that could influence CSLE1 activity, similar to how "alterations in S-acylation could also influence cellulose biosynthesis"

How does CSLE1 compare to CSLD proteins in terms of motility and trafficking?

CSLD proteins exhibit distinctive movement patterns in the plasma membrane that differ from CESA proteins. To compare CSLE1:

  • Movement pattern analysis:

    • Track fluorescently tagged CSLE1 molecules in live cells

    • Calculate key parameters such as velocity, duration, and linearity of movement

    • Compare with CSLD6, which "moves in the plasma membrane" with movements that were "significantly faster, shorter in duration and less linear than CESA10 movements"

  • Trafficking pathway investigation:

    • Determine cytoskeletal dependencies using inhibitors

    • Compare with CSLD6, where "delivery to the apical plasma membrane, but not the cell plate, depends on actin"

  • Quantitative comparison table:

ParameterCESA10CSLD6CSLE1 (predicted)
VelocitySlower"Significantly faster" To be determined
Movement patternMore linear"More circuitous" To be determined
Actin dependencyHighVariable by location To be determined
Inhibitor sensitivitySensitive to cellulose synthesis inhibitors"Insensitive to cellulose synthesis inhibitor" To be determined
  • Confinement ratio analysis:

    • Calculate "the actual trajectory distance divided by the straight-line distance between the start and end point of the trajectory"

    • Compare with CSLD6, which showed "trajectories were significantly more circuitous than CESA1"

What role might lipid microdomains play in CSLE1 function?

Lipid microdomains may significantly influence CSLE1 localization and function. To investigate:

  • Membrane domain analysis:

    • Use super-resolution microscopy to visualize CSLE1 distribution

    • Apply membrane fluorescent probes to identify specialized domains

  • S-acylation and membrane targeting:

    • Investigate if CSLE1, like CSC proteins, undergoes S-acylation that "forms microdomains within the plasma membrane"

    • Determine if these domains affect "cellulose biosynthesis by affecting the velocity of the CSC complex"

  • Sphingolipid interactions:

    • Examine whether CSLE1 associates with "lipid microdomains, enriched with sphingolipids" which "have been implicated in cellulose synthesis"

    • Test if disruption of "glycosylinositol phosphorylceramide (GIPC) synthesis" affects CSLE1 function, as these have "shown decreased cellulose biosynthesis"

  • Membrane manipulation experiments:

    • Apply drugs that disrupt membrane domains (e.g., methyl-β-cyclodextrin)

    • Test effects on CSLE1 localization and mobility

How should I analyze discrepancies between in vitro and in vivo CSLE1 activity?

When facing contradictory results between different experimental systems:

  • Systematic comparison approach:

    • Create a detailed comparison table of experimental conditions

    • Identify key variables that might explain discrepancies (pH, temperature, cofactors)

  • Validation with multiple techniques:

    • Employ "three independent approaches" similar to how researchers confirmed TIP1-CSC interaction

    • Combine biochemical, genetic, and imaging approaches

  • Consider protein modifications:

    • Assess whether the recombinant protein has the necessary post-translational modifications

    • Test if "codon optimization has the potential to cause changes in the target protein's conformation and functionality"

  • Statistical analysis:

    • Apply appropriate statistical tests with multiple biological replicates

    • Consider the experimental design principles outlined in "Experimental Design and Scientific Data Analysis" for conservation research

What statistical approaches are most appropriate for analyzing CSLE1 movement data?

To properly analyze CSLE1 dynamics data:

  • Movement metrics calculation:

    • Calculate velocities using both "kymograph measurements" and "particle tracking velocity measurements"

    • Determine confinement ratios to assess trajectory straightness

  • Comparative statistical analysis:

    • Use appropriate tests (t-test, ANOVA) to compare CSLE1 with other cellulose synthases

    • Follow scientific data analysis principles for "choosing the right statistical test" and "different methods of presenting information"

  • Data visualization approaches:

    • Create trajectory maps and kymographs

    • Generate distribution plots of velocities and movement patterns

    • Follow guidance on "how to display results" for scientific communication

  • Sample size considerations:

    • Ensure sufficient biological and technical replicates

    • Apply statistical power analysis to determine minimum sample sizes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.