Recombinant Arabidopsis thaliana Cellulose synthase-like protein G1 (CSLG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your request when placing the order. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CSLG1; At4g24010; T19F6.17; T32A16.180; Cellulose synthase-like protein G1; AtCslG1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-760
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLG1
Target Protein Sequence
METHRKNSVVGNILHTCHPCRRTIPYRIYAIFHTCGIIALMYHHVHSLVTANNTLITCLL LLSDIVLAFMWATTTSLRLNPVHRTECPEKYAAKPEDFPKLDVFICTADPYKEPPMMVVN TALSVMAYEYPSDKISVYVSDDGGSSLTFFALIEAAKFSKQWLPFCKKNNVQDRSPEVYF SSESHSRSDEAENLKMMYEDMKSRVEHVVESGKVETAFITCDQFRGVFDLWTDKFSRHDH PTIIQVLQNSETDMDNTRKYIMPNLIYVSREKSKVSPHHFKAGALNTLLRVSGVMTNSPI ILTLDCDMYSNDPATLVRALCYLTDPEIKSGLGYVQFPQKFLGISKNDIYACENKRLFII NMVGFDGLMGPTHVGTGCFFNRRAFYGPPYMLILPEINELKPYRIADKSIKAQDVLSLAH NVAGCIYEYNTNWGSKIGFRYGSLVEDYYTGFMLHCEGWRSVFCNPKKAAFYGDSPKCLV DLVGQQIRWAVGLFEMSFSKYSPITYGIKSLDLLMGLGYCNSPFKPFWSIPLTVYGLLPQ LALISGVSVFPKASDPWFWLYIILFFGAYAQDLSDFLLEGGTYRKWWNDQRMLMIKGLSS FFFGFIEFILKTLNLSTPKFNVTSKANDDDEQRKRYEQEIFDFGTSSSMFLPLTTVAIVN LLAFVWGLYGILFCGGELYLELMLVSFAVVNCLPIYGAMVLRKDDGKLSKRTCFLAGNLH VGSYCVKLLRPQVTSPLRLIHNNNTSGWFKRKKHNMNESV
Uniprot No.

Target Background

Function
CSLG1 is believed to be a Golgi-localized beta-glycan synthase responsible for polymerizing the backbones of noncellulosic polysaccharides (hemicelluloses) within the plant cell wall.
Database Links

KEGG: ath:AT4G24010

STRING: 3702.AT4G24010.1

UniGene: At.32387

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like G subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in young seedlings, primarily in the vascular tissue.

Q&A

What is the genomic organization of CSLG1 in Arabidopsis thaliana?

CSLG1 (Cellulose synthase-like protein G1) belongs to the cellulose synthase-like family in Arabidopsis thaliana. Similar to other characterized genes in A. thaliana, genomic analysis techniques such as DNA blot analysis can reveal the organization of CSLG1 within the genome. Typically, these genes contain multiple introns interrupting the coding sequence, as demonstrated in related genes like CGS1, which contains ten introns in its genomic sequence . To characterize CSLG1's genomic organization, researchers should isolate genomic DNA, perform restriction enzyme digestion, separate fragments by electrophoresis, and probe with labeled CSLG1 cDNA. This approach allows determination of gene copy number, exon-intron boundaries, and potential regulatory regions. Complementary analysis of both cDNA and genomic clones enables precise determination of coding sequences, transcriptional start sites, and prediction of protein size and structure.

How is CSLG1 functionally categorized among Arabidopsis genes?

CSLG1 belongs to the cellulose synthase-like family of proteins in Arabidopsis thaliana, which are involved in cell wall biogenesis and modification. Based on functional categorization approaches similar to those used in AraMultiOmics, CSLG1 can be classified according to Gene Ontology (GO) and Plant Ontology (PO) categories . Typically, CSLG genes participate in processes related to cell wall development, polysaccharide synthesis, and response to environmental stimuli. Functional analysis reveals that CSLG1 is part of the broader glycosyltransferase superfamily that includes cellulose synthases and participates in the synthesis of cell wall matrix polysaccharides. CSLG1 is often categorized in GO categories related to "signal transduction," "protein sorting," and responses to "abiotic stimuli and development" . This categorization helps researchers understand the broader cellular context in which CSLG1 functions and informs experimental design for functional studies.

What expression patterns does CSLG1 show across different tissues in Arabidopsis?

CSLG1 expression patterns can be analyzed using multiple approaches including transcriptomics and chromatin accessibility data. Based on methodologies similar to those used in AraMultiOmics, researchers can integrate Open Chromatin Region (OCR) tissue maps to determine tissue-specific expression patterns . Analysis with PCSD (Paired-end sequencing of Chromatin States and Dynamics) chromatin state data shows that CSLG homologs, including CSLG1, demonstrate distinct expression patterns that can be revealed through clustering techniques such as FarthestFirst . To comprehensively analyze CSLG1 expression, researchers should:

  • Collect RNA from various tissues (roots, stems, leaves, flowers, siliques)

  • Perform RT-qPCR using CSLG1-specific primers

  • Generate tissue-specific transcriptome datasets

  • Analyze chromatin accessibility in different tissues using ATAC-seq

  • Integrate these data to create an expression map

This integrated approach provides insights into both the developmental and tissue-specific regulation of CSLG1, informative for understanding its biological role in plant development.

What are the optimal conditions for recombinant expression of CSLG1 in E. coli?

The optimization of recombinant CSLG1 expression in E. coli requires a systematic experimental design approach to maximize soluble protein yield. Unlike traditional univariant methods, multivariant statistical experimental design allows for evaluation of multiple variables simultaneously while accounting for interactions between them . For CSLG1 expression, researchers should evaluate eight critical variables that affect protein expression: temperature, IPTG concentration, induction time, medium composition (base medium, carbon source, nitrogen source), initial pH, and inoculum size.

A fractional factorial design (2^8-4) with central point replicates would be appropriate, evaluating how these factors affect cell growth, biological activity, and productivity of recombinant CSLG1 . Based on similar recombinant protein studies, induction times between 4-6 hours typically yield optimal productivity levels. The expression objective should focus on achieving high yields of soluble, active CSLG1 rather than inclusion bodies, which would require additional refolding steps.

Example experimental design matrix for CSLG1 expression:

ExperimentTemperature (°C)IPTG (mM)MediumpHInduction time (h)Cell density (OD₆₀₀)Yield (mg/L)Activity (%)
1250.1LB7.040.612065
2250.1TB7.560.816072
3251.0LB7.560.69048
4251.0TB7.040.813557
5370.1LB7.540.810540
6370.1TB7.060.67532

Statistical analysis of these results would identify the most significant variables affecting CSLG1 expression and their optimal values to achieve maximum yield of biologically active protein .

How can chromatin state analysis inform CSLG1 functional studies?

Chromatin state analysis using Paired-end sequencing of Chromatin States and Dynamics (PCSD) provides valuable insights into the regulatory mechanisms governing CSLG1 expression and function. The methodology involves integrating epigenetic data with gene expression profiles to understand chromatin accessibility and potential transcription factor binding sites. For CSLG1 functional studies, researchers should implement a systematic approach similar to that used for related genes in AraMultiOmics .

First, collect chromatin state data through PCSD or similar techniques across different tissues and developmental stages. Next, apply clustering methods such as FarthestFirst to identify patterns in chromatin states among related genes. As demonstrated with homologs like CYP76C and other gene families, this approach can reveal how chromatin states correlate with differential expression patterns . For example, analysis of CSLG homologs (CSLG1, CSLG2, CSLG3) revealed distinct clustering patterns when applied to PCSD chromatin states, suggesting different regulatory mechanisms.

To leverage this information for functional studies, researchers should:

  • Identify potential regulatory elements in CSLG1 promoter regions based on chromatin accessibility

  • Design targeted mutagenesis experiments to validate these elements

  • Compare chromatin states across different conditions (abiotic stress, developmental stages)

  • Correlate chromatin state changes with differential expression

  • Identify potential transcription factors through motif analysis in accessible regions

This systematic approach provides a foundation for understanding the regulatory mechanisms controlling CSLG1 expression and informs the design of functional studies to elucidate its role in plant development and stress responses.

What complementation strategies are effective for validating CSLG1 function?

Complementation strategies provide powerful approaches for validating CSLG1 function through genetic rescue of mutant phenotypes. Drawing from techniques used for other Arabidopsis genes, researchers can implement several complementation approaches. The most direct method involves expressing the CSLG1 gene in CSLG1-deficient mutants of Arabidopsis to restore wild-type phenotypes . Alternatively, heterologous complementation can be performed by expressing CSLG1 in bacterial or yeast systems lacking related functions.

For bacterial complementation, identify a microbial mutant with a phenotype related to CSLG1's predicted function (similar to the metB E. coli mutant complementation approach used for CGS1) . The complementation vector should contain the CSLG1 coding sequence optimized for the host organism under a suitable promoter. For Arabidopsis mutant complementation, the construct should include the native promoter and terminator regions to ensure proper expression patterns.

To validate successful complementation:

  • Perform genotyping to confirm transgene integration

  • Quantify CSLG1 expression levels using RT-qPCR

  • Analyze phenotypic restoration through appropriate assays (cell wall composition, growth patterns)

  • Perform biochemical assays to confirm restoration of enzymatic activity

  • Conduct microscopy studies to evaluate cellular phenotypes

These complementation approaches provide rigorous validation of CSLG1 function and can distinguish between direct and indirect effects of gene disruption. Additionally, domain swapping or chimeric constructs can help identify functional regions within the CSLG1 protein essential for its activity.

How can differential expression of CSLG1 be analyzed in stress response studies?

Analyzing differential expression of CSLG1 in response to various stressors requires integration of transcriptomic data with appropriate statistical methods. Based on approaches used in AraMultiOmics, researchers should categorize differential expression patterns into regulatory types: up-regulation, down-regulation, both, or none . This categorization provides insights into CSLG1's role in stress response pathways.

For comprehensive analysis, researchers should employ a methodology that includes:

  • Stress treatment design with appropriate controls, time points, and replicates

  • RNA extraction and quality assessment from treated and control samples

  • RNA-seq or microarray analysis to generate global expression profiles

  • Normalization of expression data using appropriate algorithms

  • Statistical analysis to identify significant differential expression

  • Validation of expression changes through RT-qPCR

  • Integration with other omics data (proteomics, metabolomics)

To interpret CSLG1 differential expression in context, comparison with genes in related pathways is essential. For instance, analyzing CSLG1 expression alongside genes involved in cell wall biogenesis or remodeling during stress can reveal coordinated responses. Additionally, comparing CSLG1 expression patterns with homologs (CSLG2, CSLG3) can identify redundant or unique functions within the gene family .

The integration of expression data with chromatin state information can further reveal regulatory mechanisms underlying stress-induced changes in CSLG1 expression. This comprehensive approach enables researchers to distinguish between direct stress responses and secondary effects, providing a foundation for understanding CSLG1's role in plant stress adaptation.

What bioinformatic approaches best characterize CSLG1 protein domains and structure?

Comprehensive bioinformatic analysis of CSLG1 protein domains and structure requires a multi-level approach that integrates sequence analysis, structural prediction, and evolutionary conservation. The methodology should begin with primary sequence analysis to identify conserved domains, motifs, and potential catalytic sites. For glycosyltransferases like CSLG1, identification of the catalytic domain and substrate binding regions is particularly important.

The analytical workflow should include:

  • Primary sequence analysis using tools like InterPro, Pfam, and SMART to identify conserved domains

  • Multiple sequence alignment with other CSLG family members and related cellulose synthases to identify conserved residues

  • Secondary structure prediction using algorithms like PSIPRED or JPred

  • Tertiary structure modeling using homology modeling or threading approaches

  • Identification of potential active sites and substrate binding pockets

  • Analysis of transmembrane domains and topology using TMHMM or Phobius

  • Prediction of post-translational modification sites

  • Evolutionary analysis to identify functionally important regions

Similar to the approach used for analyzing the CGS1 gene product, identification of functional domains such as pyridoxal phosphate-binding sites or transit peptides is crucial . For CSLG1, special attention should be given to the glycosyltransferase domain, transmembrane regions (which anchor the protein in the plasma membrane), and potential regulatory domains.

Prediction of CSLG1's subcellular localization is also essential, as it provides insights into function. Tools like TargetP and LOCALIZER can predict the presence of transit peptides for chloroplast, mitochondrial, or secretory pathway targeting . This comprehensive bioinformatic characterization provides a foundation for experimental studies, guiding site-directed mutagenesis and functional assays.

How should researchers analyze potential functional redundancy between CSLG1 and related genes?

Functional redundancy among CSLG family members presents a significant challenge in understanding the specific role of CSLG1. To systematically address this issue, researchers should implement a multi-faceted approach integrating comparative genomics, expression analysis, and phenotypic characterization of mutants.

The first step involves comparative sequence analysis of CSLG1, CSLG2, and CSLG3 to identify shared and unique domains. Next, expression pattern analysis across tissues, developmental stages, and stress conditions can reveal differences in spatio-temporal regulation . Analyzing co-expression networks helps identify genes consistently co-regulated with specific CSLG members, suggesting functional associations.

For experimental validation of redundancy, researchers should:

  • Generate single, double, and triple mutants of CSLG family members

  • Perform detailed phenotypic analysis under normal and stress conditions

  • Conduct complementation experiments with each CSLG gene in different mutant backgrounds

  • Analyze cell wall composition in the various mutants to detect subtle differences

  • Perform protein localization studies to identify potential differences in subcellular targeting

Cluster analysis of chromatin states, as demonstrated with CYP76C and other homolog families, can provide additional insights into regulatory differences among CSLG genes . For instance, FarthestFirst clustering of PCSD chromatin states revealed that related homologs often cluster together, suggesting similar regulatory mechanisms.

To quantify functional overlap, researchers can employ a molecular phenotyping approach, measuring a comprehensive set of parameters (transcriptome, metabolome, cell wall composition) in the various mutants and calculating the degree of similarity. This systematic approach enables precise characterization of unique and redundant functions among CSLG family members, guiding future research on CSLG1.

What purification strategy yields highest purity and activity of recombinant CSLG1?

Developing an optimal purification strategy for recombinant CSLG1 requires careful consideration of protein characteristics, expression system, and intended applications. Based on approaches used for other recombinant proteins, a multi-step purification process is recommended to achieve high purity while maintaining biological activity .

The purification strategy should begin with clarification of cell lysate through centrifugation and filtration to remove cell debris. For initial capture, affinity chromatography using a tag system (His-tag, GST, or MBP) provides selective enrichment of the target protein. When designing the expression construct, placement of the affinity tag should consider potential interference with protein folding or activity. For membrane-associated proteins like CSLG1, detergent selection for solubilization is critical. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS often preserve protein structure and activity.

Following affinity purification, intermediate purification steps may include ion exchange chromatography, optimized based on CSLG1's theoretical isoelectric point. Polishing steps such as size exclusion chromatography separate aggregates and provide buffer exchange into a stabilizing formulation. Throughout purification, monitoring both protein purity (SDS-PAGE, Western blot) and functional activity (enzymatic assays) is essential.

How do different heterologous expression systems compare for CSLG1 production?

Selecting the optimal heterologous expression system for CSLG1 production requires systematic comparison of different platforms based on yield, functionality, post-translational modifications, and scalability. While E. coli remains a common choice due to its rapid growth and well-established genetic tools , membrane-associated plant proteins like CSLG1 often present challenges in bacterial systems.

A comparative analysis of expression systems should include:

Expression SystemAdvantages for CSLG1LimitationsExpected YieldPost-translational Modifications
E. coliRapid growth, economical, genetic tools availableLimited post-translational modifications, potential inclusion body formation100-250 mg/L Limited glycosylation, no lipid modifications
Yeast (P. pastoris)Higher eukaryote, secretion possible, glycosylationLonger expression time, different glycosylation pattern50-100 mg/LBasic glycosylation, some lipid modifications
Insect cellsAdvanced eukaryotic processing, proper foldingComplex media, higher cost, longer expression time10-50 mg/LMore complex glycosylation, lipid modifications
Plant expression systemsNative environment, authentic modificationsLow yield, longer expression time1-10 mg/LNative glycosylation and lipid modifications

For membrane proteins like CSLG1, eukaryotic systems often provide advantages in terms of proper folding and post-translational modifications. If bacterial expression is preferred for economic reasons, specialized E. coli strains designed for membrane protein expression (e.g., C41/C43) combined with careful optimization of expression conditions can improve results .

When comparing systems, multivariate experimental design approaches allow efficient evaluation of key parameters affecting expression in each system . The final selection should balance protein quality (functionality, modifications) with practical considerations (yield, cost, time). For structural studies, a bacterial system optimized for high yield may be sufficient, while functional studies might benefit from expression in a system providing more authentic post-translational modifications.

What are the critical quality control parameters for recombinant CSLG1?

Establishing robust quality control parameters for recombinant CSLG1 is essential for ensuring consistency and reliability in research applications. A comprehensive quality control strategy should assess purity, identity, structure, and functional activity through multiple complementary techniques.

Purity assessment should include SDS-PAGE with densitometry analysis (targeting >90% purity for most applications), size exclusion chromatography to detect aggregates, and endotoxin testing for preparations intended for in vivo studies. Protein identity confirmation requires mass spectrometry analysis (peptide mass fingerprinting or LC-MS/MS) to verify the amino acid sequence and detect any truncations or modifications.

Structural integrity assessment should include circular dichroism to evaluate secondary structure components, thermal shift assays to determine stability, and dynamic light scattering to detect aggregation. For membrane proteins like CSLG1, detergent content analysis is also critical, as excess detergent can interfere with downstream applications.

Functional assays specific to CSLG1's glycosyltransferase activity are essential quality control parameters. These may include:

  • In vitro enzymatic activity assays measuring incorporation of sugar nucleotides into growing polysaccharide chains

  • Binding assays for substrate interactions

  • Thermal stability measurements under various buffer conditions

  • Verification of proper folding through limited proteolysis

  • Assessment of oligomeric state (if applicable)

For batch-to-batch consistency, establishing reference standards and acceptance criteria for each parameter is recommended. Documentation should include detailed production parameters, purification conditions, and all quality control results. Similar to the approach used for recombinant pneumolysin, where both protein purity and functional activity (hemolytic activity) were monitored , CSLG1 quality control should balance biophysical characterization with functional validation.

How can multi-omics approaches enhance understanding of CSLG1 function?

Multi-omics integration provides a powerful framework for elucidating CSLG1 function within the broader context of cellular processes. Tools like AraMultiOmics offer methodologies for combining various data types to generate comprehensive insights into gene function . For CSLG1 research, a systematic multi-omics approach should integrate genomics, transcriptomics, proteomics, metabolomics, and chromatin dynamics data.

The integration strategy should begin with transcriptomic profiling to identify co-expressed genes and expression patterns across tissues and conditions. Proteomics approaches, including interactome analysis through co-immunoprecipitation or proximity labeling, can identify CSLG1 protein interaction partners. Metabolomics, particularly focused on cell wall components, can reveal changes in polysaccharide composition in CSLG1 mutants or overexpression lines.

Chromatin dynamics analysis through techniques such as ATAC-seq or ChIP-seq can identify regulatory elements controlling CSLG1 expression . The PCSD (Paired-end sequencing of Chromatin States and Dynamics) approach used in AraMultiOmics provides valuable information about chromatin states associated with differential expression .

To implement this multi-omics approach:

  • Generate datasets across multiple omics platforms using consistent experimental conditions

  • Apply normalization and quality control procedures specific to each data type

  • Identify correlations between different omics layers using statistical approaches

  • Apply network analysis to identify functional modules containing CSLG1

  • Integrate with publicly available datasets to expand analytical scope

  • Validate key findings through targeted experiments

This integrated approach provides a systems-level understanding of CSLG1 function, revealing both direct effects and broader impacts on cellular processes. The combination of multiple data types increases confidence in functional predictions and helps prioritize hypotheses for experimental validation.

What comparative genomics approaches reveal evolutionary insights about CSLG1?

Comparative genomics provides essential insights into the evolutionary history and functional conservation of CSLG1 across plant species. A systematic approach should combine sequence-based phylogenetic analysis with synteny mapping and functional domain conservation studies to elucidate evolutionary patterns.

The analysis should begin with identification of CSLG1 homologs across diverse plant species using reciprocal BLAST searches and orthology inference methods. Multiple sequence alignment of identified homologs enables construction of phylogenetic trees to visualize evolutionary relationships. This approach can reveal when CSLG genes diverged during plant evolution and identify potential neofunctionalization or subfunctionalization events.

Synteny analysis comparing the genomic regions containing CSLG1 across species provides insights into chromosomal rearrangements and gene duplication events. Analysis of selection pressures through calculation of dN/dS ratios (non-synonymous to synonymous substitution rates) helps identify protein regions under positive or purifying selection, indicating functional importance.

For functional domain analysis, researchers should compare conserved domains and motifs across homologs to identify core functional regions versus more variable regions. Similar to the approach used for CGS1, identification of transit peptides, catalytic domains, and regulatory regions across species reveals functional constraints .

To understand CSLG1's role in broader evolutionary context, researchers should:

  • Analyze the presence/absence pattern of CSLG genes across major plant lineages

  • Compare expression patterns of orthologs in different species when data are available

  • Correlate evolutionary patterns with differences in cell wall composition

  • Identify co-evolving gene families that may functionally interact with CSLG1

  • Analyze regulatory element conservation in promoter regions

This comprehensive comparative genomics approach provides evolutionary context for CSLG1 function and helps predict functional importance of specific protein regions based on conservation patterns.

How should researchers integrate CSLG1 expression data with metabolic pathway analysis?

Integrating CSLG1 expression data with metabolic pathway analysis requires a systematic approach that connects transcriptional regulation with biochemical outcomes. For CSLG1, which likely functions in cell wall polysaccharide synthesis, this integration is particularly valuable for understanding its role in plant development and stress responses.

The methodological approach should begin with detailed expression profiling of CSLG1 across tissues, developmental stages, and stress conditions. Next, targeted metabolomics focused on cell wall components and precursors provides biochemical context. For comprehensive integration, researchers should implement the following strategy:

  • Map CSLG1 to relevant metabolic pathways using existing databases (KEGG, PlantCyc)

  • Identify co-expressed genes within these pathways through correlation analysis

  • Perform metabolic flux analysis in wild-type versus CSLG1 mutant plants

  • Apply clustering methods to identify coordinated changes in gene expression and metabolite levels

  • Use pathway enrichment analysis to identify overrepresented pathways among co-expressed genes

As demonstrated in the analysis of volatile organic compound (VOC) pathways, clustering approaches can reveal coordination between genes involved in related metabolic processes . For example, applying clustering to PCSD chromatin states and OCR data revealed that genes in the shikimate pathway clustered together, while PAL homologs belonged to different clusters, suggesting distinct regulatory mechanisms .

To visualize integrated data, researchers should create pathway maps overlaid with expression data, metabolite levels, and chromatin state information. This multi-layered visualization enables identification of regulatory bottlenecks and potential intervention points. Additionally, comparison of wild-type and mutant metabolic profiles under various conditions can reveal condition-specific functions of CSLG1 in metabolic regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.