Recombinant Arabidopsis thaliana Chaperone protein dnaJ 13 (ATJ13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATJ13; B13; D3; At2g35720; T20F21.9; Chaperone protein dnaJ 13; AtDjB13; AtJ13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-538
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATJ13
Target Protein Sequence
MMGQEAAPTGPPNRELYALLNLSPEASDEEIRKAYRQWAQVYHPDKIQSPQMKEVATENF QRICEAYEILSDETKRLIYDLYGMEGLNSGLELGPRLSKADEIKEELERIKRRNEEAKKM AHFQPTGSILFNLSVPHFLVGDGIMRGMVMASQVQSQLSKDDAIAIGGNLAANEKSGGGV ATAILRRQISPVSSIEFVASTGLQSLIGVQTTRQLTIHSTATINISKSLSDGSINLTNTW TRQLSETSSGNIELALGMRSAITVGWKKRDENVSAAGDFKIESGGLGASARYTRKLSSKS HGRIVGRIGSNALEIELGGGRQISEFSTVRMMYTVGLKGIFWKVELHRGSQKLIVPILLS AHLAPVFATGAFIVPTSLYFLLKKFVVKPYLLKREKQKALENMEKTWGQVGEARARAEKA QQLLQTVATRKKNRQVETDGLIVTKALYGDPKAIERRNEGVEGLDSGVIDVTVPMNFLVS DSGQLKLHEGVKKSGIMGFCDPCPGQPKQLYIAYTYHSQPFEVIVGDYEELSIPQEGQ
Uniprot No.

Target Background

Function
This protein plays a continuous role in plant development, likely contributing to the structural organization of cellular compartments. It appears to be involved in resistance to oxidative stress induced by thiol-oxidizing agents such as diamide.
Gene References Into Functions
  1. Data suggests a central role for OWL1 in the very low fluence response (VLFR) pathway, crucial for plant survival under low-light conditions. [OWL1] PMID: 19808946
Database Links

KEGG: ath:AT2G35720

STRING: 3702.AT2G35720.1

UniGene: At.31

Protein Families
DnaJ family, B/II subfamily
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Constitutively expressed in roots, stems, leaves and flowers.

Q&A

What is ATJ13 and what is its molecular identity?

ATJ13 (Chaperone protein dnaJ 13) is a J-domain protein from Arabidopsis thaliana with molecular co-chaperone functionality. It is also known as AtDjB13 and has a UniProt identifier of Q39079. The protein is encoded by the ATJ13 gene (At2g35720, ORF Name: T20F21.9) and consists of 538 amino acids in its full-length form . ATJ13 belongs to one of the 51 distinct J-domain protein families identified in Arabidopsis thaliana, which collectively comprise 89 different J-domain proteins in this model plant organism . J-domain proteins are essential co-chaperones involved in protein folding, translocation, and degradation processes, and many are implicated in both biotic and abiotic stress responses in plants .

How is ATJ13 expression regulated in Arabidopsis thaliana?

While specific expression data for ATJ13 is limited in the provided search results, research on J-domain proteins in Arabidopsis indicates that they exhibit varying expression levels that can be categorized as low, medium, or moderate based on digital Northern analysis . By comparison with other J-domain proteins like AtDjA3, it's reasonable to hypothesize that ATJ13 expression may be modulated in response to various environmental stresses. For instance, AtDjA3 gene expression is regulated by NaCl, glucose, and abscisic acid (ABA) . Researchers investigating ATJ13 expression should consider:

  • Performing qRT-PCR analysis under various stress conditions

  • Analyzing promoter elements for stress-responsive motifs

  • Creating reporter gene fusions to visualize expression patterns spatiotemporally

  • Examining expression in different developmental stages and tissues

What is the predicted subcellular localization of ATJ13?

J-domain proteins in Arabidopsis thaliana are distributed throughout the cell, with members found in both soluble and membrane compartments of all cellular organelles . While the search results do not specify the exact subcellular localization of ATJ13, its function can be inferred from its sequence features and comparison with other J-domain proteins. To experimentally determine ATJ13 localization, researchers should consider:

  • Creating fluorescent protein fusions (GFP, YFP) to visualize localization in vivo

  • Performing subcellular fractionation followed by Western blot analysis

  • Using immunogold labeling for electron microscopy

  • Employing computational prediction tools that analyze targeting sequences

What approaches are recommended for studying ATJ13 function in planta?

To characterize ATJ13 function in Arabidopsis thaliana, researchers should consider multiple complementary approaches:

  • Genetic approaches:

    • T-DNA insertion lines (similar to the Salk_132923 line used for AtDjA3)

    • CRISPR/Cas9-mediated gene editing to create knockout or knockdown mutants

    • Overexpression lines using the CaMV 35S promoter

  • Phenotypic analysis:

    • Seed development and morphology assessment

    • Stress tolerance assays (salt, osmotic, temperature)

    • Germination rate and cotyledon development under various conditions

  • Molecular analysis:

    • qRT-PCR to examine expression patterns under various conditions

    • RNA-seq to identify genes affected by ATJ13 mutation

    • Protein-protein interaction studies (Y2H, BiFC, Co-IP)

Based on studies of related J-proteins like AtDjA3, researchers should particularly focus on seed development parameters and stress response phenotypes .

What are optimal conditions for handling recombinant ATJ13 protein?

For researchers working with recombinant ATJ13 protein, the following handling guidelines are recommended:

  • Storage conditions:

    • Store stock aliquots at -20°C

    • For extended storage, maintain at -20°C or -80°C

    • Prepare working aliquots that can be stored at 4°C for up to one week

    • Avoid repeated freezing and thawing cycles

  • Buffer composition:

    • Use Tris-based buffer with 50% glycerol optimized for protein stability

    • Consider additives that maintain protein function for specific applications

  • Experimental considerations:

    • Validate protein activity before use in functional assays

    • Consider tag effects on protein function if the recombinant protein includes purification tags

    • Maintain appropriate controls for experiments involving recombinant proteins

How does ATJ13 compare functionally to other J-domain proteins in Arabidopsis?

The Arabidopsis thaliana genome encodes 89 J-domain proteins categorized into 51 distinct families based on sequence comparisons and structure-function predictions . Understanding ATJ13's function in relation to this diverse family requires comparative analysis:

J-protein FamilyMembersKey Structural FeaturesKnown FunctionsStress Responses
DjB familyIncludes ATJ13J-domain, G/F-domain, zinc finger domainCo-chaperone activityVarious stress responses
DjA familyIncludes AtDjA3Complete DnaJ domain structureSeed development, ABA signalingSalt, osmotic stress, ABA response
Other J-domain proteinsVaries by familyVariable domain architecturesDiverse functions in different cellular compartmentsSpecific stress responses

Researchers should consider:

  • Performing phylogenetic analysis to determine evolutionary relationships

  • Comparing expression patterns across different J-domain proteins

  • Creating multiple mutant lines to test for functional redundancy

  • Examining interacting partners to identify shared and unique functions

How can protein-protein interactions of ATJ13 be effectively studied?

As a co-chaperone, ATJ13 likely functions through interactions with Hsp70 chaperones and various substrate proteins. Several approaches for studying these interactions include:

  • In vitro methods:

    • Pull-down assays using recombinant ATJ13

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic analysis

  • In vivo methods:

    • Yeast two-hybrid screening to identify potential interactors

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in plant cells

    • Co-immunoprecipitation followed by mass spectrometry

  • Computational approaches:

    • Protein structure modeling and docking simulations

    • Prediction of interaction sites based on conserved domains

    • Network analysis of potential interacting partners

The zinc finger domain (CxxCxGxG)4 of J-domain proteins is particularly important for mediating protein-protein interactions with target polypeptides , making this region of special interest when studying ATJ13's interactome.

What is the role of ATJ13 in plant stress responses compared to other J-domain proteins?

While the specific stress response role of ATJ13 is not detailed in the provided search results, insights can be drawn from studies of related J-domain proteins like AtDjA3:

  • ATJ13 vs. AtDjA3:

    • AtDjA3 null mutants show increased sensitivity to salt and osmotic stress

    • AtDjA3 is involved in ABA signaling pathways

    • AtDjA3 affects seed development and germination under stress conditions

  • Experimental approaches to determine ATJ13's stress role:

    • Compare wild-type, atj13 mutant, and overexpression lines under various stress conditions

    • Analyze expression of stress-responsive genes in these lines

    • Examine physiological parameters (ROS accumulation, membrane integrity, etc.)

    • Investigate interaction with known stress signaling components

  • Potential mechanisms:

    • Protein quality control during stress conditions

    • Protection of specific client proteins from aggregation

    • Modulation of signal transduction pathways

    • Regulation of transcription factors involved in stress responses

How can CRISPR/Cas9 technology be optimized for studying ATJ13 function?

CRISPR/Cas9 gene editing offers powerful approaches for functional characterization of ATJ13:

  • Guide RNA design strategies:

    • Target conserved functional domains (J-domain, zinc finger domain)

    • Design multiple gRNAs to increase editing efficiency

    • Utilize algorithms that minimize off-target effects

    • Consider targeting regulatory regions to create expression variants

  • Advanced editing approaches:

    • Base editing to introduce specific amino acid changes

    • Prime editing for precise sequence modifications

    • Multiplex editing to target ATJ13 alongside interacting partners

    • Conditional knockout systems to study tissue-specific functions

  • Phenotypic analysis workflow:

    • Screen for homozygous edited lines

    • Validate editing by sequencing

    • Compare with T-DNA insertion mutants when available

    • Perform comprehensive stress response phenotyping

What insights can structure-function analysis provide about ATJ13 specificity?

Understanding the structural basis of ATJ13 function can reveal its specific roles among the large family of J-domain proteins:

  • Key structural elements to investigate:

    • The HPD motif in the J-domain is essential for stimulating Hsp70 ATPase activity

    • The G/F-domain influences specificity of interactions with Hsp70 and client proteins

    • The zinc finger domain mediates interactions with substrate proteins

    • C-terminal sequences likely determine client specificity

  • Experimental approaches:

    • Site-directed mutagenesis of key residues

    • Domain swapping with other J-proteins

    • Structural determination by X-ray crystallography or cryo-EM

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Computational methods:

    • Homology modeling based on structures of related J-proteins

    • Molecular dynamics simulations to study conformational changes

    • Identification of conserved and variable regions among J-protein family members

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.