Recombinant Arabidopsis thaliana Chaperone protein dnaJ 49 (ATJ49)

Shipped with Ice Packs
In Stock

Description

Protein Overview

ATJ49 (UniProt ID: Q9FH28) is a 354-amino-acid chaperone protein encoded by the ATJ49 gene (synonyms: C49, At5g49060) . It features:

  • A conserved J-domain (residues 99–163) critical for interaction with Hsp70 chaperones .

  • A transmembrane helix (residues 237–257) anchoring it to membranes .

  • A DUF1977 domain (residues 258–329) of unknown function .

Domain Organization:

Domain/RegionResiduesFunction
J-domain99–163Stimulates ATPase activity of Hsp70 partners; essential for chaperone function
Transmembrane helix237–257Membrane integration; likely involved in subcellular targeting
DUF1977258–329Unknown; plant-specific domain

ATJ49 is classified as a type C J-domain protein, lacking additional canonical domains beyond the J-domain . Its membrane localization suggests roles in organelle-specific protein folding or membrane-protein complex assembly .

Recombinant Production

The recombinant ATJ49 is produced in E. coli systems, enabling high-yield purification:

  • Expression: Full-length protein (1–354 aa) fused with a His-tag .

  • Purification: Affinity chromatography via His-tag, followed by buffer exchange into Tris/PBS with trehalose for stability .

  • Reconstitution: Lyophilized powder solubilized in sterile water or glycerol-containing buffers .

Applications:

  • Structural Studies: Used in pilot analyses of membrane-protein complexes .

  • Functional Assays: Evaluates chaperone activity in ATPase stimulation and protein-folding mechanisms .

  • Plant Stress Research: Investigates roles in developmental processes and abiotic stress responses .

Research Findings

  • Genomic Context: ATJ49 is one of 89 J-domain proteins in A. thaliana, highlighting the diversity of chaperone systems in plants .

  • Expression Levels: Digital Northern analysis classifies ATJ49 as moderately expressed, suggesting constitutive roles in cellular homeostasis .

  • Functional Redundancy: Likely overlaps with other dnaJ proteins in stress adaptation, given the expanded J-protein family in plants .

Technical Considerations

  • Stability: Degrades upon repeated freeze-thaw cycles; aliquoting recommended .

  • Commercial Availability: Sold as lyophilized powder or ELISA-ready protein (50 µg to bulk quantities) .

Future Directions

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve 3D architecture.

  • Interaction Mapping: Identification of client proteins and Hsp70 partners.

  • Biotechnological Optimization: Leveraging A. thaliana expression systems for improved folding of plant-specific domains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion during production.
Synonyms
ATJ49; C49; At5g49060; K19E20.16; K20J1_3; Chaperone protein dnaJ 49; AtDjC49; AtJ49
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATJ49
Target Protein Sequence
MDGNKDDASRCLRIAEDAIVSGDKERALKFINMAKRLNPSLSVDELVAACDNLDSVSRNS SVSEKLKTMDGDDDKLETGKMKYTEENVDLVRNIIRNNDYYAILGLEKNCSVDEIRKAYR KLSLKVHPDKNKAPGSEEAFKKVSKAFTCLSDGNSRRQFDQVGIVDEFDHVQRRNRRPRR RYNTRNDFFDDEFDPEEIFRTVFGQQREVFRASHAYRTRQPRNQFREEEINVAGPSCLTI IQILPFFLLLLLAYLPFSEPDYSLHKNQSYQIPKTTQNTEISFYVRSASAFDEKFPLSSS ARANLEGNVIKEYKHFLFQSCRIELQKRRWNKKIPTPHCIELQDRGFVDRHIPI
Uniprot No.

Target Background

Function
Plays a continuous role in plant development, likely contributing to the structural organization of cellular compartments.
Database Links

KEGG: ath:AT5G49060

STRING: 3702.AT5G49060.1

UniGene: At.29808

Protein Families
DnaJ family, C/III subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Arabidopsis thaliana Chaperone protein dnaJ 49 (ATJ49)?

ATJ49 (UniProt ID: Q9FH28) is one of the 89 J-domain proteins identified in the Arabidopsis thaliana genome. It is a 354-amino acid protein classified within the J-domain protein family, which primarily functions as molecular chaperones in association with heat shock proteins (HSPs). The protein is encoded by the gene At5g49060, located on chromosome V of A. thaliana, and has several synonyms in the literature including C49, K19E20.16, K20J1_3, AtDjC49, and AtJ49 . The J-domain is a conserved region of approximately 70 amino acids that is critical for the protein's interaction with HSP70 chaperones.

How does ATJ49 relate to other J-domain proteins in Arabidopsis thaliana?

ATJ49 is one member of the extensive J-domain protein family in Arabidopsis thaliana, which comprises 89 proteins divided into 51 distinct families ranging in size from 1 to 6 members. These proteins are classified into three types: type A (9 proteins), type B (35 proteins), and type C (45 proteins), though the specific classification of ATJ49 requires further investigation. The J-domain proteins are distributed across all five chromosomes of A. thaliana, with chromosome I containing the most (27), followed by chromosome V (19), on which ATJ49 is located . This diversity suggests specialized functions for different J-domain proteins, potentially including plant-specific cellular processes beyond the canonical chaperone activities.

What is the recommended approach for expressing recombinant ATJ49 protein?

For effective expression of recombinant ATJ49, a systematic design of experiments (DoE) approach is recommended rather than the inefficient one-factor-at-a-time method. Begin with constructing an expression vector containing the ATJ49 coding sequence (1-354 amino acids) with an N-terminal His tag. E. coli is the proven expression system for this protein . Key optimization factors include: induction temperature (typically 18-25°C), IPTG concentration (0.1-1.0 mM), induction time (4-16 hours), and media composition. Applying DoE methodologies allows for testing multiple factors simultaneously, revealing optimal conditions and factor interactions that might be missed in traditional approaches. For ATJ49, expression levels should be verified by SDS-PAGE and Western blotting using anti-His antibodies. The recombinant protein typically achieves >90% purity after immobilized metal affinity chromatography (IMAC) .

How should researchers design experiments to study ATJ49 function in relation to HSP70 proteins?

When designing experiments to study ATJ49-HSP70 interactions, researchers should implement a variable-condition approach rather than fixed-parameter experiments. Begin with in vitro ATPase assays measuring HSP70 activity in the presence of varying concentrations of purified recombinant ATJ49 (typically 0.1-10 μM). Parameters that should be systematically varied include: temperature (25-42°C to encompass normal and heat stress conditions), pH (6.0-8.0), salt concentration, and nucleotide concentrations. For cellular studies, develop co-immunoprecipitation experiments with tagged versions of both proteins. To assess functional significance, design experiments that measure protein folding efficiency using model substrates like luciferase under various stress conditions . Statistical efficiency is maximized by using jittered or randomized intervals between experimental conditions rather than fixed intervals, potentially increasing experimental power by up to 10-fold .

What are the optimal storage and handling conditions for recombinant ATJ49 protein?

For optimal preservation of recombinant ATJ49 protein activity and structure, the purified protein should be stored as a lyophilized powder at -20°C to -80°C for long-term storage. Prior to use, brief centrifugation is recommended to bring contents to the bottom of the vial. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For working solutions, add glycerol to a final concentration of 5-50% (optimally 50%) and aliquot for storage at -20°C or -80°C to prevent repeated freeze-thaw cycles, which significantly reduce protein activity . For experiments spanning several days, maintain working aliquots at 4°C for up to one week. After reconstitution, the protein should be kept in Tris/PBS-based buffer at pH 8.0 containing 6% trehalose to maintain stability. These conditions have been validated to preserve protein structure and function while preventing aggregation and degradation .

How can researchers investigate the potential plant-specific functions of ATJ49 beyond its role as a co-chaperone?

To investigate novel plant-specific functions of ATJ49, researchers should employ a multi-faceted approach combining genetic, biochemical, and cellular techniques. Begin with generating ATJ49 knockout and overexpression lines in Arabidopsis thaliana using CRISPR-Cas9 or T-DNA insertion approaches. These lines should be phenotyped under various stress conditions (heat, drought, salt, pathogen exposure) and normal growth conditions, with detailed analysis of developmental stages. Complement this with transcriptome analysis (RNA-seq) comparing wild-type and mutant plants to identify altered gene expression patterns. For protein interaction studies, implement proximity-dependent biotin identification (BioID) or yeast two-hybrid screening to identify novel interaction partners beyond HSP70 proteins . Subcellular localization studies using fluorescent protein tags should be conducted to determine if ATJ49 localizes to unexpected compartments under specific conditions. Statistical analysis should employ multivariate approaches to detect subtle phenotypic changes across different experimental conditions.

What approach is recommended for studying the expression profile and regulation of ATJ49 under different stress conditions?

For comprehensive analysis of ATJ49 expression and regulation under stress conditions, researchers should implement a coordinated experimental matrix examining multiple stressors and timepoints. Begin with quantitative RT-PCR analysis of ATJ49 transcript levels under various stresses (heat, cold, drought, oxidative, salt, pathogen) at multiple timepoints (15 min, 30 min, 1h, 3h, 6h, 24h). This should be complemented with promoter-reporter constructs (ATJ49promoter::GUS) to visualize tissue-specific expression patterns. For protein-level analysis, develop specific antibodies against ATJ49 or use epitope-tagged versions expressed under native promoters. Western blot analysis should examine protein accumulation, while phosphoproteomic approaches can identify post-translational modifications under stress. Based on digital Northern analysis patterns observed for J-domain proteins in A. thaliana, ATJ49 may belong to an expression class with moderate transcript levels . Analysis should include comparison with other J-domain proteins to identify coordinated regulation patterns. Implementation of DoE principles will optimize experimental conditions while minimizing resource expenditure .

What data tables should be included in ATJ49 research publications?

Research publications focusing on ATJ49 should include comprehensive data tables that follow the FAIR principles (Findable, Accessible, Interoperable, Reusable). Essential tables should include: (1) Amino acid sequence analysis comparing ATJ49 with other J-domain proteins, highlighting conserved residues and domains; (2) Expression data under various conditions with statistical analyses; (3) Protein interaction partners identified through proteomics approaches; (4) Phenotypic data from knockout/overexpression studies; and (5) Biochemical characterization parameters . For optimal presentation, these tables should follow the NIH data table format guidelines for institutional research as referenced in search result . Tables should include clearly defined headers, appropriate units of measurement, sample sizes, p-values for statistical comparisons, and detailed footnotes explaining experimental conditions. For sequence data, inclusion of accession numbers and database references is essential for reproducibility and cross-referencing with other studies.

How should researchers design a comprehensive experimental matrix for studying ATJ49 function?

A comprehensive experimental matrix for studying ATJ49 should incorporate multiple dimensions including genetic backgrounds, environmental conditions, developmental stages, and analytical techniques. The following table structure is recommended:

Experimental FactorCondition 1Condition 2Condition 3Condition 4
Genetic BackgroundWild-typeatj49 knockoutATJ49 overexpressorComplemented line
Temperature22°C (normal)37°C (heat stress)4°C (cold stress)Temperature gradient
Developmental StageSeedlingVegetativeFloweringSenescence
Stress DurationAcute (1-3h)Short-term (24h)Long-term (3-7d)Recovery phase
Analytical MethodsTranscriptomicsProteomicsMetabolomicsPhenomics

This matrix approach enables systematic data collection across multiple variables while facilitating the application of DoE principles. Statistical analysis should employ factorial design approaches rather than one-factor-at-a-time methods, as the former can reveal important interaction effects between variables . This experimental design allows for comprehensive characterization while optimizing resource utilization and generating datasets suitable for systems biology integration.

What statistical approaches are recommended for analyzing complex data from ATJ49 functional studies?

For analyzing complex multifactorial data from ATJ49 functional studies, researchers should implement robust statistical methodologies beyond simple comparative tests. Response surface methodology (RSM) is particularly valuable for optimizing experimental conditions and understanding how multiple factors interact to influence ATJ49 function . For experiments with multiple conditions and genotypes, two-way or three-way ANOVA with appropriate post-hoc tests should be used, with careful attention to assumptions of normality and homoscedasticity. When analyzing time-series data (e.g., expression changes under stress), mixed-effects models accounting for repeated measures are recommended. For high-dimensional data such as transcriptomics or proteomics, dimension reduction techniques (PCA, t-SNE) should precede differential expression analysis. Sample size calculations should be performed prior to experiments based on anticipated effect sizes, with variable interval designs preferred over fixed interval designs, as they can increase statistical efficiency by up to 10-fold . All analyses should include appropriate corrections for multiple comparisons (e.g., Benjamini-Hochberg FDR) and clearly report both effect sizes and p-values.

What are the common challenges in expressing and purifying recombinant ATJ49, and how can they be addressed?

Common challenges in ATJ49 expression and purification include poor solubility, low yield, protein aggregation, and loss of function. To address solubility issues, modify expression conditions by lowering induction temperature (16-18°C), reducing IPTG concentration (0.1-0.5 mM), and using specialized E. coli strains designed for challenging proteins (e.g., Rosetta, Arctic Express, or SHuffle) . For persistent insolubility, consider fusion tags beyond His, such as MBP or SUMO, which can enhance solubility. If protein aggregation occurs during purification, optimize buffer conditions by screening different pH values (6.5-8.5), salt concentrations (100-500 mM NaCl), and adding stabilizing agents like glycerol (5-10%) or low concentrations of non-ionic detergents. For low yields, implement DoE approaches to systematically optimize expression parameters rather than changing one factor at a time . If the protein loses activity during purification, include protease inhibitors throughout the process and minimize the number of purification steps. Finally, consider on-column refolding procedures if the protein must be recovered from inclusion bodies.

How can researchers address conflicting results in ATJ49 functional studies?

When confronted with conflicting results in ATJ49 functional studies, researchers should implement a systematic troubleshooting approach that addresses both experimental design and biological factors. First, carefully examine methodological differences between conflicting studies, including protein expression systems, purification methods, buffer compositions, and experimental conditions. Implement side-by-side comparisons using standardized protocols to determine if methodological variations explain the discrepancies. Second, consider the genetic background of Arabidopsis thaliana lines used, as ecotype differences and the presence of unidentified mutations can influence results . Third, examine potential redundancy among J-domain proteins, as functional compensation by homologous proteins might mask phenotypes in some experimental setups but not others. Fourth, assess environmental variations, as J-domain protein function can be condition-dependent. Finally, apply DoE principles to systematically explore the parameter space around conflicting conditions to identify factors that mediate the divergent results . This approach not only resolves contradictions but can reveal important insights about context-dependent protein functions.

What strategies are recommended for investigating ATJ49 interactions with HSP70 and other proteins in planta?

For robust investigation of ATJ49 protein interactions in planta, researchers should employ complementary approaches that balance sensitivity with specificity. Begin with split-YFP (BiFC) assays in Arabidopsis protoplasts or Nicotiana benthamiana leaves to visualize potential interactions between ATJ49 and candidate partners, including various HSP70 isoforms. This should be complemented with co-immunoprecipitation experiments using epitope-tagged proteins expressed under native promoters rather than overexpression systems, which can lead to artifacts. For more comprehensive interaction studies, implement proximity-dependent approaches like BioID or TurboID, where ATJ49 is fused to a biotin ligase that biotinylates proteins in close proximity . Mass spectrometry analysis of biotinylated proteins can reveal the ATJ49 interaction landscape under various conditions. Validate key interactions using multiple techniques and quantify interaction strengths under different stress conditions. Functional significance should be assessed through genetic approaches, creating mutations in ATJ49 that specifically disrupt individual protein interactions while maintaining protein stability. Data analysis should employ appropriate statistical methods for interaction proteomics, including proper controls for non-specific binding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.