Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 1, chloroplastic (LHCB1.3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it for preferential development.
Synonyms
LHCB1.3; AB140; CAB1; At1g29930; F1N18.3; Chlorophyll a-b binding protein 1, chloroplastic; Chlorophyll a-b protein 140; CAB-140; LHCII type I CAB-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LHCB1.3
Target Protein Sequence
RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links

KEGG: ath:AT1G29930

STRING: 3702.AT1G29930.1

UniGene: At.10812

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of LHCB1 genes in Arabidopsis thaliana?

In Arabidopsis thaliana, the LHCB1 protein family is encoded by five distinct genes organized in two chromosomal clusters. Three genes (Lhcb1.1, Lhcb1.2, and Lhcb1.3) form a cluster on Chromosome 1, with Lhcb1.1 (AT1G29920) and Lhcb1.3 (AT1G29930) sharing a common bidirectional promoter. The remaining two genes (Lhcb1.4 - AT2G34430 and Lhcb1.5 - AT2G34420) form a separate cluster on Chromosome 2 .

The three genes on Chromosome 1 encode identical mature proteins with only minor differences in their transit peptide sequences. In contrast, the products of Lhcb1.4 and Lhcb1.5 differ slightly from those on Chromosome 1, featuring three amino acid substitutions in the mature protein. Additionally, Lhcb1.4 contains three extra amino acid substitutions and one deletion in the N-terminal portion that removes the phosphorylable threonine residue .

What is the stoichiometry of LHCB proteins in the light-harvesting complex?

The trimeric LHCII complex in Arabidopsis contains three different Lhcb proteins (LHCB1, LHCB2, and LHCB3) in varying proportions. Proteomic analyses have established that these proteins exist in an approximate ratio of 7:4:1 for LHCB1:LHCB2:LHCB3 . This differential abundance reflects the functional specialization of these proteins within the light-harvesting apparatus.

LHCB1 is the most abundant isoform, comprising approximately 58% of the LHCII complex, which explains why its knockout has profound effects on photosynthetic performance and plant development. The abundance ratio also suggests why plants can partially compensate for LHCB3 loss by increasing LHCB1 production, as observed in knockout studies .

How do you generate LHCB1 knockout mutants in Arabidopsis?

Creating stable LHCB1 knockout lines requires addressing the challenge of multiple, highly similar genes. The most effective approach uses CRISPR/Cas9 with carefully designed sgRNAs targeting conserved regions across all five LHCB1-encoding genes. Following is a methodological approach based on recent successful implementations:

  • sgRNA design: Use software like chop-chop to identify target sequences shared among all five LHCB1 genes. Two sgRNAs targeting different conserved regions provide redundancy and increase mutation efficiency .

  • Vector construction: Clone the selected sgRNAs into a vector containing Cas9 endonuclease under a plant-specific promoter.

  • Plant transformation: Transform Arabidopsis plants (Col-0 ecotype) using Agrobacterium-mediated floral dip method.

  • Primary screening: Select transformants on appropriate selection media, then perform initial phenotypic screening using non-photochemical quenching (NPQ) measurements, as LHCB1 loss significantly reduces photoprotective capacity .

  • Genotyping: Sequence all five LHCB1 genes in candidate lines to confirm mutations. Successful knockouts typically show frameshift mutations leading to premature stop codons or large deletions.

  • Protein verification: Confirm the absence of LHCB1 protein using immunoblotting with specific antibodies against LHCB1 .

  • Line stabilization: Self-cross promising T1 lines to obtain stable T2 homozygous plants lacking the CRISPR/Cas9 construct but retaining the mutations.

What phenotypes are associated with LHCB1 knockout in Arabidopsis?

LHCB1 knockout plants exhibit several distinct and quantifiable phenotypic alterations:

  • Visible phenotype: Plants display a characteristic pale green coloration and delayed growth and flowering compared to wild-type .

  • Chlorophyll content: Total chlorophyll content is reduced to approximately 66±6% of wild-type levels, with an uneven reduction between chlorophyll a and b, resulting in an increased chlorophyll a/b ratio .

  • Photosynthetic parameters: Knockout plants show altered non-photochemical quenching (NPQ), quantum yield of photosystem II (ΦPSII), and higher fraction of closed PSII reaction centers (1-qL) across various light intensities .

  • Development: Plants exhibit smaller rosettes and delayed flowering, indicating that the photosynthetic deficiencies translate to whole-plant developmental consequences .

The severity of these phenotypes confirms the essential role of LHCB1 in maintaining optimal photosynthetic efficiency and normal plant development under standard growth conditions.

How does LHCB1 loss affect thylakoid membrane organization?

The absence of LHCB1 significantly alters thylakoid ultrastructure in several quantifiable ways:

These structural changes demonstrate that LHCB1 plays an organizational role beyond its light-harvesting function, influencing the spatial arrangement of photosynthetic complexes within the thylakoid membrane.

How does LHCB1 contribute to state transitions and photoprotection?

LHCB1 plays critical roles in both state transitions (balancing excitation between photosystems) and photoprotection mechanisms:

State Transitions:

  • LHCB1 undergoes STN7-dependent phosphorylation during state transitions, allowing the redistribution of excitation energy between PSII and PSI .

  • In LHCB1 knockout plants, the state transition kinetics are altered. While wild-type plants show a gradual transition from State 1 to State 2 upon changes in light quality, LHCB1-deficient plants exhibit differences in both the rate and extent of these transitions .

  • Experimental data reveals that the phosphorylation level of remaining LHCII proteins is increased in LHCB1 knockout plants compared to wild-type in both State 1 and State 2, with a significantly higher relative increase in phosphorylation upon transition from State 1 to State 2 .

Photoprotection:

  • LHCB1 is essential for optimal non-photochemical quenching (NPQ), which dissipates excess excitation energy as heat .

  • Knockout plants show decreased NPQ capacity across multiple light intensities, indicating compromised photoprotective capabilities .

  • The reduction in NPQ correlates with altered thylakoid organization, suggesting structural requirements for efficient energy dissipation.

These findings highlight LHCB1's dual role in both energy distribution and photoprotection, making it a critical component for photosynthetic regulation under changing light conditions.

What compensatory mechanisms exist when LHCB1 is absent?

Plants employ several compensatory strategies when LHCB1 is absent, though these mechanisms only partially restore normal function:

  • Protein upregulation: In LHCB1 knockout plants, LHCB2 shows the most significant compensatory increase (1.42±0.33-fold change), followed by modest increases in LHCB4 (1.27±0.15-fold change) and LHCB5 (1.24±0.40-fold change) .

  • Trimer composition: In the absence of LHCB1, the M trimers of LHCII are preserved, indicating that LHCB1 is replaced by increased incorporation of LHCB2 and possibly other isoforms .

  • Photosystem stoichiometry adjustment: The photosynthetic electron transport equilibrium is partially maintained through a lower PSI/PSII reaction center ratio and by alterations in the phosphorylation state of the remaining LHCII components and PSII .

  • Phosphorylation changes: LHCB1 knockout plants show increased phosphorylation of remaining LHCII proteins in both State 1 and State 2, suggesting a regulatory response to compensate for the altered excitation balance .

Despite these compensatory mechanisms, the resulting photosynthetic apparatus remains suboptimal, as evidenced by the pale phenotype, growth delay, and altered photosynthetic parameters. This underscores the non-redundant nature of LHCB1's role in photosynthesis.

What experimental techniques are most effective for studying LHCB1.3 function in vivo?

Several complementary techniques provide comprehensive insights into LHCB1.3 function:

  • Chlorophyll fluorescence analysis:

    • Pulse Amplitude Modulation (PAM) fluorometry enables real-time monitoring of PSII efficiency (ΦPSII), NPQ, and the redox state of PSII electron acceptors (qL) .

    • State transition measurements using controlled red/far-red light shifts help quantify the mobility and function of LHCB1.3 in energy redistribution between photosystems .

  • Thylakoid membrane isolation and analysis:

    • Blue-native PAGE separation of membrane complexes reveals the integration of LHCB1.3 into higher-order structures.

    • Differential solubilization with detergents of varying strengths can discriminate between loosely and tightly bound LHCII populations.

  • Phosphorylation studies:

    • Phos-tag SDS-PAGE followed by immunoblotting detects phosphorylated LHCB1.3 species.

    • Radiolabeling with 33P and subsequent autoradiography provides quantitative phosphorylation data.

    • Mass spectrometry identifies specific phosphorylation sites and their occupancy levels.

  • Structural analysis:

    • Electron microscopy of isolated thylakoids reveals grana stacking alterations in LHCB1-deficient plants .

    • Cryo-electron microscopy of purified PSII-LHCII supercomplexes provides structural insights into LHCB1.3's role in complex assembly.

  • Protein-protein interaction studies:

    • Split-GFP or FRET analysis in chloroplasts can reveal dynamic interactions between LHCB1.3 and other photosynthetic proteins.

    • Crosslinking mass spectrometry identifies interaction interfaces at the amino acid level.

These methodologies, when integrated, provide a comprehensive understanding of LHCB1.3's multiple roles in photosynthetic light harvesting, photoprotection, and thylakoid organization.

How do different LHCB1 knockout strategies compare?

Various approaches have been employed to study LHCB1 function, each with distinct advantages and limitations:

Knockout StrategyAdvantagesLimitationsKey Findings
CRISPR/Cas9 targeting all five LHCB1 genesComplete protein elimination; stable inheritanceLabor-intensive screening; potential off-target effectsPale phenotype; reduced chlorophyll; altered thylakoid structure; compromised NPQ
Artificial miRNA (amiRNA)Targeted approach; can be inducibleIncomplete knockdown; potential for expression recoveryReduced trimeric LHCII; altered state transitions; reduced NPQ
Antisense RNA targeting LHCB2 (affecting both LHCB1 and LHCB2)Simultaneous reduction of multiple antenna proteinsNon-specific effects; difficult to attribute phenotypes to specific proteinsCombined effect of LHCB1 and LHCB2 reduction on photosynthesis
Double amiRNA targeting both LHCB1 and LHCB2Complete elimination of LHCII trimersComplex phenotype interpretation due to multiple protein effectsPlants without LHCII trimers; severely compromised NPQ
Chlorophyll b synthesis mutantsAffects all Chl b-containing proteinsNon-specific effects on multiple antenna proteinsDifferent antenna isoforms affected differently depending on growth light intensity

The CRISPR/Cas9 approach targeting all five LHCB1 genes represents the most specific and complete elimination strategy, providing the clearest insights into LHCB1's unique functions.

What are the photosynthetic parameters of LHCB1 knockout plants compared to wild-type?

The loss of LHCB1 significantly impacts several photosynthetic parameters across varying light intensities:

ParameterWild-type ResponseLHCB1 Knockout ResponseSignificance
Non-photochemical quenching (NPQ)Efficient induction at moderate to high light intensitiesSignificantly reduced across all light intensitiesDemonstrates LHCB1's essential role in photoprotection
PSII quantum yield (ΦPSII)Gradual decrease with increasing light intensityMore rapid decrease with increasing light intensityIndicates reduced light utilization efficiency in knockout plants
Closed PSII centers (1-qL)Gradual increase with light intensityHigher values across all light intensitiesSuggests over-excitation of PSII and reduced electron transport capacity
State transition coefficient (qT)Moderate valueAltered kinetics with faster transitionsIndicates LHCB1's role in regulating energy distribution between photosystems
Chlorophyll contentNormal (100%)Reduced (66±6%)Reflects LHCB1's major contribution to chlorophyll binding capacity
Chlorophyll a/b ratioLowerHigherIndicates preferential loss of chlorophyll b associated with LHCII trimers

These data collectively demonstrate that LHCB1 is critical for maintaining optimal photosynthetic efficiency, particularly under varying light conditions.

How does LHCB1 phosphorylation affect its function?

Phosphorylation is a key regulatory mechanism affecting LHCB1 function:

The phosphorylation status of LHCB1 thus serves as a molecular switch controlling energy distribution within the photosynthetic apparatus, highlighting the protein's role in dynamic light adaptation.

What are the most promising research avenues for LHCB1.3 studies?

Several promising research directions could advance our understanding of LHCB1.3 function:

  • Isoform-specific functions: Developing strategies to selectively express individual LHCB1 isoforms in knockout backgrounds could reveal subtle functional differences between the five Arabidopsis LHCB1 proteins, particularly between the products of Chromosome 1 genes (LHCB1.1-1.3) versus Chromosome 2 genes (LHCB1.4-1.5).

  • Structural biology: High-resolution cryo-electron microscopy of PSII-LHCII supercomplexes from wild-type and mutant plants could reveal precisely how LHCB1 influences the macrostructural arrangement of the antenna system and thylakoid organization.

  • Environmental adaptation: Investigating how LHCB1 phosphorylation and function respond to various environmental stresses (drought, high light, temperature extremes) could reveal its role in stress acclimation.

  • Synthetic biology approaches: Engineering modified versions of LHCB1.3 with altered phosphorylation sites or protein-protein interaction domains could provide insights into structure-function relationships and potentially create plants with enhanced photosynthetic efficiency.

  • Systems biology integration: Combining transcriptomic, proteomic, and metabolomic analyses of LHCB1 knockout plants under various conditions could reveal broader metabolic consequences of altered light harvesting and identify unexpected regulatory connections.

These research directions promise to expand our understanding of how this abundant photosynthetic protein contributes to plant fitness and adaptation in changing environments.

What technical challenges remain in LHCB1.3 research?

Despite significant progress, several technical challenges persist in LHCB1.3 research:

  • Protein purification: Obtaining pure, properly folded recombinant LHCB1.3 with appropriate pigment binding remains challenging due to the complex assembly requirements of light-harvesting complexes.

  • Isoform discrimination: Developing antibodies or analytical techniques that can distinguish between the highly similar LHCB1 isoforms would enable more precise studies of their individual contributions.

  • In vivo dynamics: Tracking the real-time movement and association of LHCB1.3 within the thylakoid membrane during state transitions and other regulatory processes requires development of minimally invasive imaging techniques with sufficient spatiotemporal resolution.

  • Post-translational modifications: Beyond phosphorylation, other potential post-translational modifications of LHCB1.3 remain poorly characterized but may significantly influence its function.

  • Functional redundancy: Disentangling the specific contribution of LHCB1.3 from functional overlap with other LHCB proteins requires more sophisticated genetic approaches, such as inducible knockouts combined with complementation studies.

Addressing these challenges will require interdisciplinary approaches combining structural biology, advanced microscopy, proteomics, and genetic engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.