Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 2, chloroplastic (LHCB1.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
LHCB1.1; AB165; CAB2; LHCP-B; At1g29920; F1N18.4; Chlorophyll a-b binding protein 2, chloroplastic; Chlorophyll a-b protein 165; CAB-165; LHCII type I CAB-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LHCB1.1
Target Protein Sequence
RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links

KEGG: ath:AT1G29910

STRING: 3702.AT1G29920.1

UniGene: At.10812

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic function of LHCB1.1 in Arabidopsis thaliana?

LHCB1.1 is one of five genes encoding the Lhcb1 protein, a major component of light-harvesting complex II (LHCII) trimers in Arabidopsis thaliana. These proteins function primarily in light harvesting during photosynthesis, capturing photons and transferring the excitation energy to the photosystem reaction centers. Lhcb1 specifically plays a critical role in the formation of LHCII trimers and contributes to grana stacking and thylakoid membrane organization . Unlike its close relative Lhcb2, Lhcb1 appears to be more essential for maintaining the structural integrity of the photosynthetic apparatus rather than directly mediating state transitions .

How does LHCB1.1 differ from other LHCII proteins?

While LHCB1.1 shares high sequence similarity with other LHCII proteins (particularly Lhcb2), research using artificial microRNA lines has revealed distinct functional roles. Lhcb1 (including LHCB1.1) is primarily important for LHCII trimer formation and thylakoid membrane structure, whereas Lhcb2 is specifically required for state transitions . Plants lacking Lhcb1 show a dramatic reduction in LHCII trimers and altered thylakoid organization. In contrast, Lhcb2-deficient plants maintain normal LHCII trimer levels (with Lhcb1 replacing Lhcb2) but cannot perform state transitions . This functional differentiation explains why both proteins have been evolutionarily conserved despite their structural similarities.

What are reliable methods for recombinant expression of LHCB1.1?

For recombinant expression of LHCB1.1, researchers should consider both prokaryotic and eukaryotic expression systems, each with distinct advantages. For structural studies, E. coli-based expression using specialized strains like Rosetta(DE3) with chloroplast transit peptide removal is effective. The protein should be expressed at lower temperatures (16-18°C) after IPTG induction to improve folding. For functional studies, expression in Pichia pastoris or baculovirus-infected insect cells provides better post-translational modifications. Purification typically involves immobilized metal affinity chromatography followed by size exclusion chromatography. Critically, all steps should be performed under dim green light to prevent chlorophyll photodamage, and detergents like β-DM (0.03-0.05%) should be included in all buffers to maintain protein solubility .

How can researchers effectively differentiate between Lhcb1 and Lhcb2 proteins in experimental settings?

Differentiating between Lhcb1 and Lhcb2 proteins presents significant challenges due to their 87% amino acid sequence similarity. The most effective approach involves combining multiple techniques:

  • Immunoblotting with phospho-specific antibodies: Phosphorylation kinetics differ between Lhcb1 and Lhcb2, with Lhcb2 showing more rapid phosphorylation during state transitions .

  • Mass spectrometry: Using targeted proteomics focusing on unique N-terminal peptides for accurate quantification.

  • Genetic approaches: Utilizing amiRNA lines specifically targeting either Lhcb1 or Lhcb2, as demonstrated in research by Leoni et al. .

  • Blue-native PAGE with second-dimension SDS-PAGE: This technique allows separation of different LHCII trimer configurations, as shown in experimental data where Lhcb2 homotrimers display distinct migration patterns compared to Lhcb1-containing complexes .

Table 1: Key distinguishing features between Lhcb1 and Lhcb2 proteins

FeatureLhcb1Lhcb2
Encoding genes in ArabidopsisFive genes (chromosome 1)Three genes (chromosome 2)
Phosphorylation kineticsSlowerRapid during state transitions
Functional roleCritical for LHCII trimer formationCritical for state transitions
Impact when depletedReduced LHCII trimers, altered thylakoid structureNormal LHCII levels, impaired state transitions
Chlorophyll a/b ratio when depletedIncreased to ~4.0Similar to wild-type (~3.2)

What strategies can overcome the challenges of generating LHCB1.1 knockout mutants?

Generating true LHCB1.1 knockout mutants presents significant challenges due to gene redundancy (five genes encoding Lhcb1) and their close genetic linkage on chromosome 1. Researchers should implement these methodological approaches:

  • Artificial microRNA (amiRNA) technology: This has proven more effective than T-DNA insertion or antisense approaches. Design amiRNAs targeting conserved regions unique to LHCB1.1 but distinct from Lhcb2 sequences. Multiple amiRNA constructs should be tested, as demonstrated in research where "amiLhcb1v1" successfully silenced Lhcb1 expression while maintaining specificity .

  • CRISPR-Cas9 multiplexed targeting: Design guide RNAs targeting conserved regions across all five Lhcb1 genes simultaneously.

  • Inducible silencing systems: Employ estradiol or dexamethasone-inducible promoters controlling amiRNA expression to overcome potential lethality of constitutive knockouts.

  • Selective complementation: In amiRNA lines targeting all Lhcb1 genes, reintroduce codon-optimized LHCB1.1 resistant to silencing to study specific isoform functions.

The most successful published approach used amiLhcb1v1 constructs, screening 30 independent transformation events to identify lines with the lowest Lhcb1 levels .

How do phenotypes differ between single LHCB1.1 mutants and plants lacking multiple LHCII proteins?

Research comparing amiLhcb1 (depleted in all Lhcb1 proteins including LHCB1.1) and amiLhcb2 plants reveals distinct phenotypic consequences depending on which LHCII component is compromised:

Lhcb1-depleted plants (amiLhcb1) exhibit:

  • Slower growth rate with smaller, paler leaves

  • ~30% reduction in chlorophyll content

  • Elevated chlorophyll a/b ratio (4.0 vs 3.2 in wild-type)

  • Dramatically reduced LHCII trimers

  • Decreased grana stacking (4.38 ± 0.10 layers vs 5.65 ± 0.28 in wild-type)

  • Impaired thylakoid reorganization during state transitions

  • Stunted growth under fluctuating light conditions (142.55 ± 19.34 mg vs 386.43 ± 37.49 mg in wild-type)

In contrast, Lhcb2-depleted plants (amiLhcb2) show:

  • Normal growth rate and pigmentation under standard conditions

  • Normal LHCII trimer formation (Lhcb1 compensates)

  • More uniform grana size distribution

  • Inability to perform state transitions

  • Stunted growth under fluctuating light conditions (154.72 ± 22.54 mg vs 386.43 ± 37.49 mg in wild-type)

These distinct phenotypes highlight the complementary but non-redundant functions of different LHCII components.

How does LHCB1.1 interact with other components of photosystem complexes?

LHCB1.1 engages in multiple protein-protein interactions that are critical for photosynthetic function. When analyzing these interactions using blue-native PAGE and biochemical techniques, researchers have observed:

  • PSII Supercomplex Formation: LHCB1.1 forms part of LHCII trimers that bind to PSII at specific positions designated as S (strongly bound) and M (moderately bound). In wild-type plants, this results in formation of C₂S₂M and C₂S₂M₂ supercomplexes .

  • Hierarchical Assembly: When Lhcb1 is depleted (amiLhcb1), PSII complexes form smaller C₂S and C₂S₂ configurations, suggesting that Lhcb1 is essential for the assembly of larger supercomplexes .

  • Thylakoid Organization: Lhcb1-containing LHCII trimers play a structural role in grana formation, as evidenced by the reduced grana stacking in amiLhcb1 plants (4.38 ± 0.10 layers compared to 5.65 ± 0.28 in wild-type) .

  • Trimerization Partners: LHCB1.1 can form heterotrimers with Lhcb2 and Lhcb3. Importantly, Lhcb3 appears unable to form homotrimers and requires Lhcb1 for stable integration into LHCII trimers, as demonstrated by the altered migration pattern of Lhcb3 in amiLhcb1 plants .

What is the molecular basis for LHCB1.1's role in state transitions compared to Lhcb2?

The differential roles of LHCB1.1 and Lhcb2 in state transitions stem from their distinct molecular properties and interactions. Research has revealed:

  • Phosphorylation Dynamics: Lhcb2 undergoes more rapid phosphorylation than Lhcb1 during the initial phase of state transitions, making it the primary responder to changing light conditions .

  • PSI Binding Specificity: Only phosphorylated Lhcb2-containing LHCII trimers can form the state transition-specific PSI-LHCII complex. In amiLhcb2 plants, this complex is absent despite normal levels of LHCII trimers (composed primarily of Lhcb1), demonstrating that Lhcb1 cannot functionally substitute for Lhcb2 in this specific interaction .

  • Structural Roles: Lhcb1 provides the structural foundation for state transitions by maintaining appropriate thylakoid membrane organization. In amiLhcb1 plants, the thylakoid ultrastructure lacks the flexibility required for membrane reorganization during state transitions .

  • Evolutionary Conservation: The distinct properties of Lhcb1 and Lhcb2 reflect their complementary roles that evolved before the split of angiosperm and gymnosperm lineages more than 300 million years ago, suggesting strong selective pressure to maintain both proteins .

How is LHCB1.1 expression regulated at the transcriptional and post-transcriptional levels?

LHCB1.1 expression is regulated through sophisticated transcriptional and post-transcriptional mechanisms:

  • Transcriptional Regulation:

    • Light-responsive elements in the promoter region integrate signals from photoreceptors

    • Circadian clock regulation coordinates expression with daily light cycles

    • Retrograde signaling from chloroplasts modulates nuclear gene expression

  • Post-transcriptional Regulation:

    • RNA-binding proteins like AtGRP7 (GLYCINE-RICH RNA-BINDING PROTEIN 7) directly bind to LHCB1.1 transcripts, modulating their stability

    • AtGRP7 binding sites contain a conserved U-rich motif, as identified through individual-nucleotide resolution UV crosslinking and immunoprecipitation (iCLIP)

    • This interaction affects LHCB1.1 transcript half-life: shorter in plants overexpressing AtGRP7 and longer in atgrp7 mutants

    • AtGRP7 regulates LHCB1.1 in a dose-dependent manner, with transcript abundance reduced in AtGRP7 overexpression lines and elevated in atgrp7 mutants

  • Circadian Oscillation:

    • LHCB1.1 exhibits robust circadian oscillation in transcript levels

    • AtGRP7 binding modulates these oscillations by affecting RNA stability

What methodologies are most effective for studying diurnal and circadian regulation of LHCB1.1?

To comprehensively study the diurnal and circadian regulation of LHCB1.1, researchers should employ a multi-faceted methodological approach:

  • Time-Course Sampling Strategies:

    • Entrain plants under 12h light/12h dark cycles for at least 7 days

    • Transfer to constant light conditions (for circadian studies)

    • Sample every 4 hours over 48-72 hours

    • Maintain strict temperature control (±0.5°C) to prevent temperature-dependent effects

  • Transcript Analysis Techniques:

    • Quantitative RT-PCR targeting LHCB1.1-specific regions

    • RNA-Seq for genome-wide expression context

    • Nuclear run-on assays to distinguish transcriptional from post-transcriptional regulation

  • Protein-RNA Interaction Studies:

    • Individual-nucleotide resolution UV crosslinking and immunoprecipitation (iCLIP) to identify RNA-binding proteins like AtGRP7 that interact with LHCB1.1

    • RNA immunoprecipitation followed by high-throughput sequencing (RIP-Seq)

    • RNA stability assays using cordycepin or actinomycin D treatment followed by time-course sampling

  • Promoter Analysis:

    • Luciferase reporter constructs with LHCB1.1 promoter variants

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the LHCB1.1 promoter

Research has demonstrated that these approaches can effectively characterize the complex regulatory network controlling LHCB1.1 expression, revealing how RNA-binding proteins like AtGRP7 coordinate with the circadian clock to modulate LHCB1.1 transcript stability and abundance throughout the day-night cycle .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.