Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 3, chloroplastic (LHCB1.2)

Shipped with Ice Packs
In Stock

Description

Introduction to LHCB1.2

LHCB1.2 (Light-Harvesting Chlorophyll a-b Binding Protein 1.2) is a chloroplastic protein critical to photosynthesis in Arabidopsis thaliana. It belongs to the LHC (Light-Harvesting Complex) family, which includes proteins responsible for capturing light energy and transferring it to photosystems. LHCB1.2 is one of five isoforms encoded by the LHCB1 gene family, with distinct genetic clusters on Chromosomes 1 and 2 . Recombinant LHCB1.2 is produced in Escherichia coli with a His-tag for purification and structural studies .

Key Features of Recombinant LHCB1.2

ParameterSpecification
Gene IDAt1g29910
UniProt IDQ8VZ87
SourceE. coli
TagN-terminal His-tag (36-267aa mature protein)
Purity>90% (SDS-PAGE)
Amino Acid SequenceRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK

LHCB1.2 shares 100% sequence homology with other LHCB1 isoforms (e.g., LHCB1.1, LHCB1.3, LHCB1.4, LHCB1.5) and partial homology with LHCB2 (93%) and LHCB3 (87%) .

Expression and Production

Recombinant LHCB1.2 is expressed in E. coli and purified via affinity chromatography using its His-tag. The mature protein spans residues 36–267, excluding the transit peptide . The recombinant version retains structural and functional properties critical for light-harvesting studies.

Functional Role in Photosynthesis

LHCB1.2 is integral to:

  1. Light Harvesting: As part of LHCII trimers, it binds chlorophylls and carotenoids to capture light energy .

  2. PSII Supercomplex Stability: LHCB1.2-containing trimers interact with PSII cores and monomeric antennae (e.g., LHCB4, LHCB5) to form stable supercomplexes .

  3. State Transitions: Phosphorylation of LHCB2 (not LHCB1.2) drives LHCII redistribution between PSII and PSI, but LHCB1.2 compensates for LHCB2 loss in mutants .

Experimental Applications

ApplicationMethodOutcome
Structural ValidationCryo-EM of recombinant LHCIIConfirmed near-native structure
Antibody-Based AssaysWestern blotting with anti-LHCB1.2 antibodiesDetects cross-reactivity with LHCB1.1/1.3/1.5 (100%) and partial with LHCB2/LHCB3
Biochemical StudiesPull-down assays with His-tagged LHCB1.2Interacts with plastid proteins (e.g., POR, CHLP)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LHCB1.2; AB180; CAB3; LHCP-A; At1g29910; F1N18.5; Chlorophyll a-b binding protein 3, chloroplastic; Chlorophyll a-b protein 180; CAB-180; LHCII type I CAB-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LHCB1.2
Target Protein Sequence
RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Database Links

KEGG: ath:AT1G29910

UniGene: At.10812

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of LHCB1.2 in photosynthesis?

LHCB1.2 is one of the five genes in Arabidopsis thaliana encoding the LHCB1 protein, which is the major component of the trimeric Light-Harvesting Complex II (LHCII). These complexes serve two critical functions:

  • Increasing the absorption cross-section of photosystems by capturing and transferring light energy to the reaction centers

  • Playing a central role in photoprotection by dissipating excess absorbed light energy in an inducible and regulated fashion

The loss of LHCB1 results in smaller Photosystem II absorption cross-section, altered chlorophyll repartition between photosystems (favoring Photosystem I excitation), and changes in thylakoid structure, all highlighting its importance in photosynthetic function .

How does LHCB1.2 differ from other LHCB proteins in Arabidopsis thaliana?

LHCB1.2 (AT1G29910) belongs to the LHCB1 subfamily, which is distinguished from other LHCB proteins in several ways:

Genomic organization and protein structure:

  • LHCB1.2 is part of a gene cluster on Chromosome 1 that includes Lhcb1.1 (AT1G29920) and Lhcb1.3 (AT1G29930)

  • The mature proteins encoded by Lhcb1.1, Lhcb1.2, and Lhcb1.3 are identical, with differences only in their transit peptide sequences

  • LHCB1 is distinct from LHCB2 and LHCB3, which have different functional roles in state transitions

Abundance and organization:

  • LHCB1 is the most abundant isoform in the trimeric LHCII, with a ratio of approximately 7:4:1 for LHCB1:LHCB2:LHCB3 in Arabidopsis

  • Unlike the minor LHCBs (LHCB4-6) which exist as monomers, LHCB1 primarily forms trimers

What is the genomic organization of LHCB1 genes in Arabidopsis thaliana?

The five LHCB1 genes in Arabidopsis are organized in two distinct clusters:

Chromosome 1 cluster:

  • Lhcb1.1 (AT1G29920)

  • Lhcb1.2 (AT1G29910)

  • Lhcb1.3 (AT1G29930)

  • Lhcb1.1 and Lhcb1.3 share a common bidirectional promoter

Chromosome 2 cluster:

  • Lhcb1.4 (AT2G34430)

  • Lhcb1.5 (AT2G34420)

This genomic organization makes it challenging to obtain multiple insertional mutants by crossing, necessitating approaches like CRISPR/Cas9 for simultaneous mutation of all five genes .

How is the expression of LHCB1.2 regulated in different tissues and developmental stages?

LHCB1 genes show distinctive expression patterns across plant tissues:

  • LHCB1.1 (and likely other LHCB1 genes) shows expression in cotyledons, hypocotyls, and vascular cells of roots

  • Expression is generally absent in roots, except for LHCB1.1 which expresses in vascular cells

  • Light serves as a crucial positional information source regulating LHCB gene expression during plant development

Developmental regulation involves various photoreceptors and signaling pathways that respond to light parameters, triggering changes in gene expression that orchestrate morphogenetic processes .

What approaches can be used to generate and purify recombinant LHCB1.2 protein?

Researchers can employ several strategies to generate and purify recombinant LHCB1.2:

In planta expression system:

  • Create a chimeric LHCB1.2 gene with a C-terminal polyhistidine tag (His6)

  • Transform plants (e.g., tobacco) with this construct

  • Extract and solubilize thylakoid membranes with a detergent

  • Purify using affinity chromatography with Ni²⁺-NTA-agarose

  • Elute with imidazole to obtain recombinant monomers

This approach has key advantages:

  • Ensures proper folding and pigment incorporation

  • Allows selective purification of recombinant protein from native LHCII

  • Permits reconstitution of functional trimers after purification

The yield of this method is approximately 0.7% of total LHCII, making it a viable alternative to bacterial expression systems for producing eukaryotic membrane proteins .

What methods are most effective for studying LHCB1.2 interactions and complex formation?

Several complementary approaches have proven effective:

Native gel electrophoresis:

Biochemical techniques:

  • Immunoprecipitation using specific antibodies against LHCB1

  • Affinity purification using tagged recombinant proteins

Structural studies:

  • Two-dimensional crystallization of purified complexes

  • Electron diffraction analysis to study structural organization

Spectroscopic methods:

  • Fluorescence decay measurements to determine PSI/(PSI+PSII) chlorophyll ratio

  • Electrochromic shift (ECS) measurements to assess photochemical rates of PSI and PSII

How can CRISPR/Cas9 be used to generate LHCB1 knockout mutants?

The close genomic proximity of LHCB1 genes makes traditional T-DNA insertion mutagenesis challenging. CRISPR/Cas9 offers an effective alternative:

Design strategy:

  • Design sgRNAs targeting conserved regions shared among all five LHCB1 genes

  • Two sgRNAs can target all genes simultaneously due to high sequence similarity

  • Use software like chop-chop to identify optimal target sequences

Implementation and screening:

  • Transform plants with constructs containing sgRNAs and Cas9

  • Screen T1 generation for reduced NPQ (non-photochemical quenching) as a phenotypic marker

  • Sequence each targeted gene in T2 lines to confirm mutations

  • Perform protein analysis to verify complete knockout

Mutation types observed in successful knockouts:

  • Single nucleotide insertions or deletions causing frameshifts

  • Larger deletions between targeted sites

  • Chromosomal rearrangements between closely linked genes

What alternative approaches exist for generating LHCB1-deficient plants?

When CRISPR/Cas9 is not feasible, researchers have successfully employed these alternatives:

Artificial microRNA (amiRNA):

  • Design amiRNAs specifically targeting LHCB1 or LHCB2 transcripts

  • Transform plants and screen for reduced protein levels

  • Select lines with the strongest silencing effect for further analysis

This approach has advantages and limitations:

  • Allows specific targeting of either LHCB1 or LHCB2 independently

  • Typically results in knockdown rather than complete knockout

  • Expression levels may vary between lines and generations

  • May allow residual protein accumulation (e.g., amiLhcb1 plants retain detectable LHCB1)

Antisense approach:

  • Introduces antisense constructs against LHCB genes

  • Often results in simultaneous inhibition of multiple LHCB genes due to sequence similarity

  • Example: antisense constructs against LHCB2 typically affect LHCB1 expression as well

How does the loss of LHCB1 affect photosynthetic performance?

LHCB1 knockout mutants display several photosynthetic alterations:

Light harvesting changes:

  • Smaller PSII absorption cross-section while PSI absorption cross-section remains unaffected

  • Altered chlorophyll repartition between photosystems, favoring PSI excitation

  • Increased PSI/(PSI+PSII) chlorophyll ratio (approximately 0.75 in L1ko versus 0.63 in wild type)

Electron transport adaptations:

  • Lower PSI/PSII reaction center ratio helps maintain electron transport equilibrium

  • Dephosphorylation of remaining LHCII and PSII components as a compensatory mechanism

  • Reduced non-photochemical quenching (NPQ) capacity

Growth and physiological effects:

  • Pale green phenotype with chlorophyll content reduced to 66±6% of wild type

  • Higher chlorophyll a/b ratio (3.6±0.1 compared to 3.2±0.1 in wild type)

  • Growth delay but otherwise normal development

What role does LHCB1 play in state transitions and photoprotection?

LHCB1 has specific functions in both processes:

State transitions:

  • Both LHCB1 and LHCB2 are necessary for state transitions, but neither alone is sufficient

  • LHCB1 lacks the rapid phosphorylation kinetics of LHCB2

  • In the stable PSI-LHCI-LHCII complex, LHCB1 is mostly non-phosphorylated

  • Phosphorylation is regulated by the STN7 kinase and the PPH1/TAP38 phosphatase

Photoprotection mechanisms:

  • LHCB1 is required for non-photochemical quenching (NPQ)

  • L1ko mutants show reduced NPQ capacity, confirming its role in photoprotection

  • LHCB1 homotrimers may dissociate from PSII and perform quenching by interacting with PsbS and zeaxanthin

How does LHCB1 contribute to thylakoid membrane organization?

LHCB1 plays a critical role in determining thylakoid ultrastructure:

Grana formation:

  • Loss of LHCB1 results in fewer membrane layers per grana stack

  • Grana width is significantly reduced in L1ko mutants

  • LHCB1 appears essential for normal grana stacking and organization

Protein complex distribution:

  • LHCB1 influences the spatial arrangement of photosystems

  • Absence of LHCB1 alters the distribution of protein complexes between grana and stroma lamellae regions

  • The organization of supercomplexes containing different combinations of PSI, PSII, and LHCII is disrupted

What methods can be used to analyze thylakoid membrane changes in LHCB1 mutants?

Researchers employ several complementary techniques:

Electron microscopy:

Native gel electrophoresis:

  • lpBN-PAGE with digitonin solubilization to preserve membrane organization

  • Analysis of supercomplexes and megacomplexes

Spectroscopic methods:

  • Electrochromic shift (ECS) measurements to assess photosystem distribution

  • Fluorescence decay kinetics to determine photosystem stoichiometry and organization

How can LHCB1.2 be exploited for engineering improved photosynthetic efficiency?

Understanding LHCB1.2 function opens several engineering opportunities:

Antenna size optimization:

  • Modulating LHCB1 levels can adjust light-harvesting capacity

  • Tailoring antenna size to specific light environments could improve photosynthetic efficiency

  • Precise editing of LHCB1 genes may allow fine-tuning of photosystem excitation balance

State transition enhancement:

  • Engineering LHCB1 phosphorylation sites might improve dynamic responses to changing light conditions

  • Modifying the interaction between LHCB1 and other components could enhance energy distribution between photosystems

Photoprotection improvement:

  • Optimizing LHCB1's role in non-photochemical quenching could enhance plant tolerance to high light stress

  • Engineering faster relaxation of photoprotective mechanisms might reduce losses during light intensity fluctuations

What do comparative studies between LHCB1 and LHCB2 reveal about specialized functions in photosynthesis?

Comparative analysis has revealed important functional distinctions:

Phosphorylation dynamics:

  • LHCB2 phosphorylation occurs more rapidly than LHCB1

  • The first phase of state transitions appears to be mediated primarily by LHCB2

PSI association:

  • LHCB2 mediates the association of LHCII to PSI during state transitions

  • The phosphorylated form of LHCB2 is enriched in the PSI-LHCI-LHCII complex

  • LHCB1, in this complex, is mostly non-phosphorylated

Evolutionary conservation:

  • The functional distinctions between LHCB1 and LHCB2 have been maintained for hundreds of millions of years

  • Green algae like Chlamydomonas have a different situation with less specialization between LHC proteins

  • The specialized roles suggest evolutionary pressure to maintain both protein types in seed plants

What are common challenges in generating recombinant LHCB1.2 and how can they be addressed?

Researchers often encounter these challenges when working with recombinant LHCB1.2:

Protein folding and pigment incorporation:

  • Challenge: Ensuring proper folding and pigment binding in heterologous systems

  • Solution: Use in planta expression systems where the native chlorophyll synthesis machinery is present

Purification difficulties:

  • Challenge: Separating recombinant from native LHCII proteins

  • Solution: Add affinity tags (e.g., His6) at the C-terminus which allows selective purification

  • Approach: Use nickel-chelating resin for affinity chromatography

Maintaining native-like properties:

  • Challenge: Preserving functional characteristics during purification

  • Solution: Monitor chlorophyll a/b ratio throughout purification to ensure no significant loss of pigments

  • Method: Verify ability of purified monomers to form trimers after detergent dilution

What controls are essential when analyzing LHCB1 knockout or knockdown plants?

Proper experimental design requires several critical controls:

Genetic controls:

  • Sequence verification of all five LHCB1 genes to confirm mutations

  • Analysis of multiple independent transformation events to rule out position effects

  • Complementation studies to confirm phenotypes are due to LHCB1 loss

Protein analysis controls:

  • Dilution series of wild-type samples to establish detection limits for immunoblotting

  • Quantification of other LHCII proteins to assess compensatory changes

  • Analysis of PSI and PSII core components to evaluate stoichiometric adjustments

Physiological measurement controls:

  • Comparison of plants grown under identical conditions

  • Multiple measurements across different light intensities

  • Assessment of developmental stage effects

LHCB1 Gene Information in Arabidopsis thaliana

Gene NameLocus IDChromosomeMature ProteinNotable Features
Lhcb1.1AT1G299201Identical to Lhcb1.2/1.3Shares bidirectional promoter with Lhcb1.3
Lhcb1.2AT1G299101Identical to Lhcb1.1/1.3Part of chromosome 1 cluster
Lhcb1.3AT1G299301Identical to Lhcb1.1/1.2Shares bidirectional promoter with Lhcb1.1
Lhcb1.4AT2G3443023 amino acid substitutions + 3 extra substitutionsLacks phosphorylatable threonine
Lhcb1.5AT2G3442023 amino acid substitutionsPart of chromosome 2 cluster

Photosynthetic Parameters in LHCB1 Knockout Mutants

ParameterWild TypeLHCB1 KnockoutChange (%)Significance
Total Chlorophyll Content100%66±6%-34%p < 0.01
Chlorophyll a/b Ratio3.2±0.13.6±0.1+12.5%p < 0.01
PSI/(PSI+PSII) Chl Ratio0.630.75+19%p < 0.01
PSI/PSII RC Ratio0.79±0.060.66±0.02-16.5%p < 0.01
CEF Contribution (% of total)27.4±5.8%25.5±2.7%-6.9%Not significant
State Transition Capacity (qT)0.09±0.010.04±0.01-55.6%p < 0.01

Compensatory Changes in Protein Expression in LHCB1-deficient Plants

ProteinamiLhcb1 PlantsCRISPR L1ko Mutants
LHCB1Residual amountsUndetectable
LHCB2~50% increaseSlight increase
LHCB3~30% increaseNo significant change
LHCB4-6No significant changeNo significant change
STN7 kinaseIncreasedNot reported
PPH1/TAP38 phosphataseTendency toward decrease (not significant)Not reported
PSII core subunits (PsbA-D)Not reportedNo significant change

What emerging technologies could advance our understanding of LHCB1.2 function?

Several cutting-edge approaches show promise for deepening our understanding:

Cryo-electron microscopy:

  • Visualizing LHCII megacomplexes at near-atomic resolution

  • Capturing dynamic state transition intermediates

  • Determining structural changes during photoprotection

Base editing and prime editing:

  • Precise modification of LHCB1 phosphorylation sites without double-strand breaks

  • Introduction of specific amino acid changes to test functional hypotheses

  • Engineering novel regulatory properties

Multi-omics integration:

  • Combining transcriptomics, proteomics, and metabolomics to understand systemic responses to LHCB1 modification

  • Identifying previously unknown regulatory connections and compensatory mechanisms

What are the key unresolved questions regarding LHCB1.2 function?

Despite significant progress, several fundamental questions remain:

Functional redundancy:

  • Why are multiple, nearly identical LHCB1 genes maintained in the genome?

  • Are there subtle functional differences between LHCB1 proteins encoded by different genes?

  • What evolutionary pressures maintain this redundancy?

Dynamic regulation:

  • How are LHCB1 genes differentially regulated under various environmental conditions?

  • What signaling pathways fine-tune the LHCB1:LHCB2:LHCB3 ratio?

  • How is LHCB1 involved in long-term acclimation versus short-term responses?

Structural organization:

  • What specific interactions does LHCB1 form within the thylakoid membrane?

  • How does LHCB1 contribute to the formation and maintenance of grana stacks?

  • What is the molecular basis for LHCB1's role in determining thylakoid architecture?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.