Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP26, chloroplastic (LHCB5)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP26, chloroplastic (LHCB5), also known as LHCIIc or light-harvesting complex II protein 5, is a protein that functions as a light-harvesting chlorophyll a/b-binding component . LHCB5 is found in Arabidopsis thaliana, also known as mouse-ear cress .

Function and Significance

LHCB5 is a member of the light-harvesting chlorophyll a/b-binding (LHCB) protein family, which are among the most abundant membrane proteins in nature . These proteins play a crucial role in:

  • Light Harvesting: LHCB5, along with other chlorophyll a/b binding antenna proteins like CP24 and CP26, participates in light harvesting and the regulation of photosynthesis .

  • Photosystem II (PSII) Regulation: LHCB5 influences the efficiency of energy transfer from the trimeric light-harvesting complex II (LHCII) to the reaction center of photosystem II (PSII) . It affects the physical connection of LHCII to PSII and the formation of PSII reaction center-depleted domains in grana partitions .

  • Stomatal Response to Abscisic Acid (ABA): LHCBs, including LHCB5, are involved in the responsiveness of stomatal movement to ABA, which impacts plant tolerance to drought stress . Disrupting any LHCB member reduces stomatal sensitivity to ABA, while overexpression of LHCB6 enhances it .

  • Reactive Oxygen Species (ROS) Homeostasis: LHCBs may participate in ABA signaling by modulating ROS homeostasis .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LHCB5; At4g10340; F24G24.140; Chlorophyll a-b binding protein CP26, chloroplastic; LHCB5; LHCIIc; Light-harvesting complex II protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
49-280
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LHCB5
Target Protein Sequence
SKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFA KYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIP INLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKN GRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAPTL
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Gene References Into Functions

Related Research:

  1. Dynamics in the CP26 and CP24 minor antenna complexes. PMID: 21641329
  2. Femtosecond transient absorption study on the light-harvesting pigment-protein complexes CP26 (Lhcb5) and CP24 (Lhcb6) of photosystem II. PMID: 21156149
  3. Aggregation-dependent quenching in monomeric and trimeric Lhcb proteins. PMID: 20584907
  4. Analysis of xanthophyll binding in LHC proteins, showing a pI change in the Lhcb5 photosystem II subunit (CP26) upon zeaxanthin binding. PMID: 15749754
  5. Photosynthesis impact in plants lacking CP24 (decreased electron transport, lower DeltapH, reduced nonphotochemical quenching, and growth limitations), but not in CP26 mutants. PMID: 18381925
  6. Occupancy and functional architecture of pigment binding sites in photosystem II antenna complex Lhcb5. PMID: 19129188
Database Links

KEGG: ath:AT4G10340

STRING: 3702.AT4G10340.1

UniGene: At.23060

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CP26 (LHCB5) in plant photosynthesis?

CP26 (LHCB5) serves as a chlorophyll a/b binding protein within the inner layer of Photosystem II (PSII) antenna system. It functions primarily in light harvesting and energy transfer to reaction centers, while potentially participating in photoprotective mechanisms. CP26 is highly conserved across plants and green algae, indicating its evolutionary importance .

What is the pigment composition of recombinant CP26?

Reconstituted Arabidopsis thaliana CP26 binds approximately nine chlorophyll molecules with a characteristic chlorophyll a/b ratio of 2.1 ± 0.1, which corresponds to six chlorophyll a and three chlorophyll b molecules . This ratio is significant for understanding the protein's light-harvesting properties, as chlorophyll a and chlorophyll b have distinct absorption spectra that collectively broaden the wavelength range for light capture.

In addition to chlorophylls, CP26 binds multiple carotenoid pigments. Evidence suggests the presence of three carotenoid binding sites accommodating xanthophylls such as lutein, neoxanthin, and xanthophyll cycle pigments (violaxanthin and zeaxanthin) . The pigment composition is critical for both structural stability and function, as demonstrated by reconstitution experiments with various xanthophyll combinations.

How does CP26 relate structurally to other light-harvesting complex proteins?

CP26 belongs to the light-harvesting complex (LHC) protein family, sharing structural similarities with other members. Sequence analysis and mutational studies have revealed that CP26 contains chlorophyll binding sites that can be identified by comparison with other LHC polypeptides including LHCB1, LHCB4 (CP29), LHCA1, and LHCA3 .

While the major light-harvesting complex LHCII (primarily composed of LHCB1) typically forms trimers, CP26 exists as a monomer in the thylakoid membrane. This structural characteristic likely relates to its specific positioning and function within the photosynthetic apparatus. CP26 contains an inner chlorophyll a cluster that is conserved among LHC proteins , highlighting the evolutionary relationship between these antenna complexes.

What happens to photosystem function when CP26 is depleted?

Antisense inhibition studies of CP26 have revealed several important functional consequences:

What methodologies are most effective for recombinant expression and reconstitution of CP26?

Successful recombinant expression and reconstitution of functional CP26 can be achieved through the following optimized protocol:

Expression system:

  • Clone the mature CP26 (LHCB5) sequence from Arabidopsis thaliana (GenBank accession number AF134129) into a suitable expression vector such as pQE-50 .

  • Transform into Escherichia coli strain SG13009 for protein overexpression .

  • The expressed apoprotein accumulates in inclusion bodies, which protects it from proteolytic degradation.

Reconstitution procedure:

  • Purify the apoprotein from inclusion bodies.

  • Perform in vitro reconstitution by adding purified pigments in specific ratios:

    • Chlorophyll a and b at a ratio of approximately 2.8:1

    • Carotenoids at a concentration of 83.3 μM

    • Total chlorophylls at 231.5 μM

  • Include appropriate detergents during the reconstitution process.

  • Purify the reconstituted complex by sucrose gradient ultracentrifugation.

This methodology allows researchers to obtain stable, monomeric CP26 complexes with native-like pigment composition and spectroscopic properties suitable for further biochemical and biophysical studies.

How do mutations in specific chlorophyll binding sites affect CP26 structure and function?

Mutational analysis has provided critical insights into the structure-function relationships of CP26 chlorophyll binding sites. The effects of mutations on various parameters are summarized in Table 1:

MutationTarget SiteChl a/b RatioReconstitution Yield (%)Thermal StabilityPrimary Effect
Wild Type-2.1 ± 0.1100Standard-
E65V/R181LChl-602No stable complex0-Inhibits folding
E129VChl-6062.425ReducedLoss of Chl b
E137V/R140LChl-609No stable complex0-Inhibits folding
E176V/R70LChl-610No stable complex0-Inhibits folding
N179FChl-6121.785Slightly reducedLoss of Chl a

Data compiled from

Key findings from mutational studies include:

  • Mutations affecting Chl-602, Chl-609, and Chl-610 binding sites completely inhibit protein folding, indicating these chlorophylls are essential for CP26 structure .

  • Most mutations decrease the chlorophyll a/b ratio, suggesting that chlorophyll a is the predominant ligand at most binding sites .

  • The E129V mutation (affecting Chl-606) uniquely increases the Chl a/b ratio, indicating this site specifically binds chlorophyll b in the wild-type protein .

  • All mutations reduce protein stability during thermal denaturation, demonstrating that each chlorophyll binding site contributes to the cooperative process of CP26 folding and stabilization .

What is the role of CP26 in non-photochemical quenching (NPQ) and photoprotection?

The involvement of CP26 in non-photochemical quenching (NPQ), particularly the rapidly reversible energy-dependent component (qE), has been investigated through antisense studies:

Current evidence suggests that while CP26 may contribute to NPQ, it is not absolutely essential for this photoprotective process, raising questions about functional redundancy among antenna proteins.

How do carotenoid binding properties affect CP26 function and stability?

CP26 has been reconstituted with various xanthophyll combinations to investigate carotenoid binding properties and their functional implications. Table 2 summarizes key findings:

Xanthophyll CombinationComplex StabilitySpectroscopic PropertiesFunctional Implications
Lutein only (L)StableBaselineEssential for complex formation
Violaxanthin only (V)ReducedAltered absorptionLower thermal stability
Zeaxanthin only (Z)ReducedRed-shifted absorptionPotential quenching state
Lutein + Violaxanthin (LV)EnhancedNative-likeNatural state in low light
Lutein + Zeaxanthin (LZ)EnhancedModified energy transferHigh-light adaptation
Lutein + Neoxanthin (LN)EnhancedNative-likeStructural stabilization

Data derived from

Key insights regarding carotenoid interactions include:

  • Reconstitution experiments indicate three distinct carotenoid binding sites in CP26 .

  • Lutein appears essential for stable complex formation, while neoxanthin alone cannot support reconstitution of CP26 .

  • Xanthophyll substitution naturally occurs in vivo during operation of the xanthophyll cycle, with violaxanthin converting to zeaxanthin under high light conditions .

  • The replacement of violaxanthin with zeaxanthin affects both spectroscopic properties and thermal stability of the complex, potentially relating to its photoprotective function .

  • The binding pockets for xanthophyll cycle pigments must be accessible to enzymes that catalyze deepoxidation/epoxidation reactions, suggesting a dynamic protein environment .

What techniques can quantitatively assess changes in photosystem organization when CP26 is altered?

Multiple complementary approaches can evaluate how CP26 deficiency affects photosystem organization:

  • Chlorophyll fluorescence analysis:

    • Measurement of minimal (F0) and maximal (Fm) fluorescence in intact leaves and isolated chloroplasts.

    • Calculation of maximum quantum efficiency (Fv/Fm) to assess PSII functionality.

    • Analysis of fluorescence induction kinetics to evaluate energy distribution.

    • Quantification of non-photochemical quenching capacity and kinetics.

  • Biochemical characterization:

    • Determination of chlorophyll a/b ratios in isolated thylakoid membranes.

    • Quantification of pigment composition, particularly xanthophyll cycle components.

    • Analysis of protein composition using SDS-PAGE and immunoblotting with specific antibodies.

    • Assessment of protein phosphorylation status, particularly for state transition analysis.

  • Structural analysis:

    • Electron microscopy to examine thylakoid membrane organization.

    • Isolation and characterization of PSII-LHCII supercomplexes.

    • Investigation of PSII stability through time-course measurements of photochemical efficiency.

The combination of these techniques provides a comprehensive understanding of how CP26 contributes to the organization and function of the photosynthetic apparatus. Research has shown that CP26 antisense plants display altered PSII function that can be quantified through chlorophyll fluorescence parameters, including changes in F0 and Fm levels and accelerated degradation of PSII function in isolated chloroplasts .

How can CP26 mutational studies inform strategies for improving photosynthetic efficiency?

Understanding the structure-function relationships of CP26 through mutational analysis offers several potential applications for enhancing photosynthetic efficiency:

What are the challenges in expressing recombinant CP26 with native-like properties?

Researchers face several challenges when attempting to produce recombinant CP26 with properties that accurately reflect those of the native protein:

  • Pigment incorporation: Achieving the correct stoichiometry and binding specificity of chlorophylls and carotenoids requires careful optimization of reconstitution conditions. The correct Chl a/b ratio of 2.1 is particularly important for native-like spectroscopic properties .

  • Protein folding: The formation of properly folded CP26 depends on cooperative interactions between the protein and its pigments. Mutations affecting critical chlorophyll binding sites can completely prevent successful reconstitution .

  • Stability considerations: Recombinant CP26 shows variable stability depending on its pigment composition. Thermal stability tests reveal that complexes with different xanthophyll compositions exhibit distinct denaturation profiles .

  • Functional validation: Ensuring that recombinant CP26 exhibits native-like energy transfer and quenching properties requires sophisticated spectroscopic techniques.

  • Scale-up limitations: Producing sufficient quantities of pure, homogeneous recombinant CP26 for structural studies remains challenging, particularly for techniques requiring large amounts of protein such as crystallography.

How do CP26 and CP29 cooperate in antenna organization and function?

The functional relationship between CP26 and CP29, both minor antenna proteins of PSII, reveals important insights about photosystem organization:

  • Antisense studies targeting CP29 have revealed a decrease in CP24 protein levels, indicating physical interactions between these antenna complexes that may extend to include CP26 in larger supercomplexes .

  • Both CP26 and CP29 are positioned between the inner core antenna and the major LHCII complexes, suggesting complementary roles in energy funneling to reaction centers .

  • While both proteins have been implicated in non-photochemical quenching, antisense studies show that plants can perform energy-dependent quenching even when either protein is substantially reduced .

  • The differential effects on chlorophyll fluorescence parameters (F0 and Fm) observed in CP26 versus CP29 antisense plants suggest distinct roles in organizing the PSII antenna system .

  • Together, these proteins likely contribute to the fine-tuning of energy distribution and photoprotection in response to changing environmental conditions, providing adaptive flexibility to the photosynthetic apparatus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.