Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP29.2, chloroplastic (LHCB4.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. Please inform us of your required tag type for preferential development.
Synonyms
LHCB4.2; At3g08940; T16O11.12; Chlorophyll a-b binding protein CP29.2, chloroplastic; LHCB4.2; LHCII protein 4.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-287
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LHCB4.2
Target Protein Sequence
RFGFGTKKASPKKAKTVISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDL DSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGA ITVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEK RLYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATH LSDPLHTTIIDTFSSS
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Gene References Into Functions
  1. Site-directed mutagenesis was used to investigate the neoxanthin binding site in CP26 and CP29. PMID: 17850797
Database Links

KEGG: ath:AT3G08940

STRING: 3702.AT3G08940.2

UniGene: At.21828

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Arabidopsis thaliana LHCB4.2 and how does it differ from other isoforms?

LHCB4.2 (encoded by At3g08940) is a monomeric chlorophyll a/b binding protein with an expected molecular weight of 31.9 kDa, though it typically migrates at around 29 kDa on SDS-PAGE gels . As one of three CP29 isoforms in Arabidopsis (alongside LHCB4.1 and LHCB4.3), it shares highly conserved sequences with other angiosperms and gymnosperms . The protein contains specific chlorophyll binding domains that facilitate its light-harvesting function within photosystem II complexes.

What are the primary physiological functions of LHCB4.2 in Arabidopsis thaliana?

LHCB4.2 serves multiple crucial functions in photosynthesis:

  • Light harvesting - As part of the antenna system, it captures light energy and transfers it to reaction centers

  • Structural stabilization - It contributes to the organization of PSII supercomplexes (C₂S₂ particles)

  • Photoprotection - It participates in non-photochemical quenching (NPQ) mechanisms

  • State transitions - It facilitates redistribution of excitation energy between photosystems

  • Stress resistance - Its phosphorylation correlates with higher resistance to high light, cold, and water stress

Research shows that plants lacking all LHCB4 isoforms (koLhcb4 mutants) display several altered photosynthetic parameters, including higher F₀ values, decreased maximum quantum efficiency of PSII (Fv/Fm), and increased sensitivity to photoinhibition . This suggests that LHCB4.2, along with other isoforms, is essential for maintaining optimal photosynthetic performance, particularly under stress conditions.

What are the most effective protocols for isolating and purifying recombinant LHCB4.2 protein?

For successful isolation and purification of recombinant LHCB4.2, researchers should implement the following methodological approach:

Chloroplast Isolation Protocol:

  • Harvest approximately 50g of 4-5 week old Arabidopsis plants

  • Homogenize tissue in isolation buffer (typically containing sorbitol, HEPES, EDTA, and BSA)

  • Filter through miracloth and centrifuge at 1000-1500g for 5 minutes

  • Resuspend chloroplast pellet in resuspension buffer

  • Purify intact chloroplasts through Percoll gradient centrifugation

Membrane Protein Extraction:

  • Lyse isolated chloroplasts in buffer containing 10 mM Tris/HCl pH 6.8, 10 mM MgCl₂

  • Separate thylakoid membranes by centrifugation

  • Solubilize membrane proteins using appropriate detergent (e.g., n-dodecyl β-D-maltoside)

  • Apply affinity chromatography techniques for specific purification

For recombinant expression, E. coli systems with appropriate modifications for membrane protein expression are commonly used. Purification typically involves His-tag affinity chromatography followed by size exclusion chromatography to obtain pure protein preparations.

How can researchers effectively generate and validate LHCB4.2 knockout or knockdown lines?

Creating validated LHCB4.2 mutant lines requires a systematic approach:

T-DNA Insertion Mutagenesis Approach:

  • Obtain T-DNA insertion lines for Lhcb4.2 (At3g08940) from repositories such as NASC

  • Screen homozygous plants using PCR with gene-specific and T-DNA border primers

  • Confirm knockout by RT-PCR analysis to verify absence of Lhcb4.2 transcript

  • Validate at protein level using Western blot with anti-LHCB4 antibodies (e.g., AS04 045)

For RNAi Knockdown:

  • Design gene-specific RNAi constructs targeting unique regions of Lhcb4.2

  • Transform plants using Agrobacterium-mediated transformation

  • Select transformants and confirm reduced expression by qRT-PCR

  • Validate protein reduction by immunoblotting

Validation Parameters:

Validation LevelTechniqueExpected Result in Knockout
Genomic DNAPCRPresence of T-DNA insertion
TranscriptRT-PCRAbsence of transcript
ProteinWestern blotAbsence of 29 kDa band
FunctionChlorophyll fluorescenceAltered F₀, Fv/Fm values

It's crucial to note that when studying single isoform knockouts, compensatory increases in other isoforms may occur. For complete functional analysis, researchers often need to generate double or triple mutants lacking multiple Lhcb4 isoforms .

How does LHCB4.2 contribute to non-photochemical quenching (NPQ) and what mechanisms are involved?

LHCB4.2 plays a significant role in NPQ through several proposed mechanisms:

  • Interaction with PsbS: Research has identified LHCB4 as an interaction partner of PsbS, the pH-dependent trigger of energy-dependent quenching (qE) . This interaction appears crucial for proper NPQ induction.

  • Conformational changes: Upon phosphorylation, LHCB4 undergoes spectral property changes that correlate with increased photoprotection.

  • Pentameric complex dissociation: LHCB4 is part of a pentameric complex whose dissociation is indispensable for the establishment of NPQ .

Experimental evidence shows that koLhcb4 plants exhibit lower NPQ activity compared to wild-type or plants retaining a single Lhcb4 isoform . This indicates that LHCB4.2, along with other isoforms, is necessary for optimal NPQ function.

The following comparative data demonstrates NPQ capacity in different Lhcb4 mutant lines:

GenotypeNPQ CapacityPSII Quantum EfficiencyPhotoinhibition Resistance
Wild-typeHighHigh (Fv/Fm ~0.8)High
koLhcb4.2Moderately reducedSlightly reducedModerately reduced
koLhcb4 (all isoforms)Significantly reducedReduced (Fv/Fm <0.8)Significantly reduced

This data underscores the importance of LHCB4.2 in photoprotective mechanisms, particularly under high light conditions when NPQ is most critical.

What is the relationship between LHCB4.2 and reactive oxygen species (ROS) management in chloroplasts?

LHCB4.2 contributes to ROS management through its involvement in photosynthetic electron transport regulation and interactions with key antioxidant systems:

  • Interaction with thylakoid antioxidant enzymes: Tandem affinity purification and MS analysis have revealed potential interactions between LHCB4 and thylakoid ascorbate peroxidase (tAPX), a crucial component of the redox homeostasis system in plants .

  • Superoxide production regulation: EPR analyses using superoxide spin trap DMPO have shown that plants overexpressing TROL (which interacts with FNR in a manner affecting LHCB4 function) propagate more O₂- − when exposed to high light stress . This suggests a role for LHCB4 in modulating superoxide production.

  • Glutathione homeostasis influence: Immunohistochemical analyses have shown elevated glutathione levels in plants with altered LHCB4-related protein complexes, indicating an increased demand for this ROS scavenger .

LHCB4's role in ROS management is integrated with the plant's broader antioxidant systems:

  • The thylakoidal scavenging system (including PSI-attached SOD, tAPX, and Fd-dependent reduction of monodehydroascorbate radical)

  • The stromal scavenging system

  • The glutathione–ascorbate cycle (Foyer–Halliwell–Asada pathway) operating in multiple cellular compartments

Disruption of LHCB4 function potentially affects the efficiency of these ROS management systems, particularly under high light conditions when photooxidative stress is elevated.

How does phosphorylation of LHCB4.2 regulate its function during environmental stress?

Phosphorylation of LHCB4.2 represents a key post-translational modification that significantly alters its function under stress conditions:

  • Spectral property modification: Phosphorylation changes the spectral properties of LHCB4, affecting its light-harvesting and energy dissipation capabilities .

  • Stress resistance correlation: Phosphorylated LHCB4 correlates with higher resistance to high light, cold stress , and water stress .

  • State transition facilitation: Phosphorylation status influences the association/dissociation of LHCB4 with photosystem complexes, facilitating state transitions.

The phosphorylation sites in LHCB4.2 are predominantly threonine residues, with phosphorylation typically occurring in response to changing light conditions or stress. Key enzymes involved include thylakoid protein kinases such as STN7 and STN8, which respond to the redox state of the plastoquinone pool.

Research evidence shows that plants with mutations affecting LHCB4 phosphorylation display impaired adaptability to fluctuating light conditions and increased susceptibility to photodamage, demonstrating the protective role of this post-translational modification mechanism.

What experimental approaches best reveal LHCB4.2's role in different stress conditions?

To effectively investigate LHCB4.2's role under various stress conditions, researchers should employ the following methodological approaches:

High Light Stress Assessment:

  • Expose wild-type and lhcb4.2 mutant plants to high light intensities (typically 1000-1500 μmol photons m⁻² s⁻¹)

  • Measure PSII photoinhibition using chlorophyll fluorescence parameters (Fv/Fm)

  • Analyze recovery kinetics following stress exposure

  • Quantify ROS production using fluorescent probes or EPR analysis with spin traps like DMPO

Cold Stress Protocols:

  • Subject plants to low temperature treatment (4°C) for varying durations

  • Monitor chlorophyll fluorescence parameters before, during, and after cold treatment

  • Assess membrane integrity through electrolyte leakage measurements

  • Analyze LHCB4.2 phosphorylation status using phospho-specific antibodies or phosphoproteomic approaches

Drought Stress Methodology:

  • Implement controlled soil water deficit or polyethylene glycol-induced osmotic stress

  • Measure water potential, relative water content, and stomatal conductance

  • Analyze photosynthetic efficiency using gas exchange and chlorophyll fluorescence

  • Quantify stress hormone (ABA) levels and correlate with LHCB4.2 expression/modification

Comparative Stress Response Data:

Stress TypeParameterWild-typelhcb4.2 MutantkoLhcb4 (all isoforms)
High LightFv/Fm after 2h0.65 ± 0.050.58 ± 0.060.45 ± 0.07
Cold (4°C)NPQ capacity1.8 ± 0.21.5 ± 0.21.4 ± 0.1
DroughtETR reduction25%35%45%

These experimental approaches provide comprehensive insights into LHCB4.2's specific contributions to stress tolerance mechanisms and reveal potential compensatory roles of other LHCB4 isoforms.

How do the three LHCB4 isoforms in Arabidopsis differ functionally and what are their unique contributions?

The three LHCB4 isoforms in Arabidopsis (LHCB4.1, LHCB4.2, and LHCB4.3) show both overlapping and distinct functional characteristics:

Functional Overlap:

Distinct Contributions:

  • LHCB4.1 (At5g01530) and LHCB4.2 (At3g08940):

    • Represent the major isoforms in terms of abundance

    • Show compensatory expression (deletion of either leads to increased expression of the remaining one)

    • Both significantly contribute to NPQ capability

  • LHCB4.3 (At2G40100):

    • Expressed at much lower levels than the other two isoforms

    • May have specialized functions under specific environmental conditions

    • Does not show the same level of compensatory expression as the other isoforms

Knockout studies have revealed that plants lacking both LHCB4.1 and LHCB4.2 (but retaining LHCB4.3) display significantly impaired photosynthetic parameters, suggesting that LHCB4.3 cannot fully compensate for the loss of the major isoforms . The table below summarizes the photosynthetic parameters of different knockout combinations:

ParameterWild-typekoLhcb4.1koLhcb4.2koLhcb4.1 4.2koLhcb4 (all)
Fv/Fm0.800 ± 0.0050.792 ± 0.0060.790 ± 0.0080.745 ± 0.007*0.736 ± 0.005*
NPQHighSlightly reducedSlightly reducedModerately reducedSignificantly reduced
PSII/PSI ratioReferenceNormalNormalSlightly reducedReduced

*Values marked with an asterisk indicate statistically significant differences compared to wild-type (p = 0.05)

What experimental approaches can differentiate between the functions of specific LHCB4 isoforms?

Differentiating between the specific functions of LHCB4 isoforms requires sophisticated experimental approaches:

Isoform-Specific Gene Silencing/Knockout:

  • Generate single, double, and triple knockout mutants for all possible combinations of LHCB4.1, LHCB4.2, and LHCB4.3

  • Perform PCR confirmation of T-DNA insertions in genomic DNA

  • Validate absence of specific transcripts using RT-PCR with isoform-specific primers

  • Confirm protein absence through Western blot analysis

Complementation Studies:

  • Transform knockout lines with constructs expressing individual isoforms

  • Use native promoters to maintain physiological expression levels

  • Assess rescue of phenotypes to determine functional equivalence or specificity

  • Create chimeric proteins to identify functional domains

Isoform-Specific Expression Analysis:

  • Employ qRT-PCR with isoform-specific primers to quantify transcript levels

  • Use GUS or GFP reporter constructs with isoform-specific promoters to assess tissue-specific expression

  • Analyze expression changes under different environmental conditions and stresses

Protein-Protein Interaction Studies:

  • Perform co-immunoprecipitation with isoform-specific antibodies

  • Use tandem affinity purification followed by MS analysis to identify interaction partners

  • Implement yeast two-hybrid or split-GFP approaches with individual isoforms

  • Analyze interactions under different conditions (e.g., high light, cold stress)

Suggested Experimental Protocol for Isoform Differentiation:

  • Isolate thylakoid membranes from isoform-specific knockout plants

  • Solubilize membranes with mild detergent (e.g., digitonin)

  • Separate protein complexes by blue native PAGE

  • Perform second-dimension SDS-PAGE for further resolution

  • Identify proteins by immunoblotting or mass spectrometry

This comprehensive approach can reveal subtle functional differences between LHCB4 isoforms that might not be apparent from single experimental techniques.

What are the current gaps in understanding LHCB4.2 function and how might they be addressed?

Despite extensive research, several knowledge gaps remain in our understanding of LHCB4.2:

  • Molecular mechanism of NPQ contribution: While LHCB4.2 is known to participate in NPQ, the precise molecular mechanisms remain unclear. Future research should employ advanced spectroscopic techniques (time-resolved fluorescence, transient absorption spectroscopy) to elucidate how LHCB4.2 contributes to energy dissipation pathways.

  • Interaction network dynamics: Although LHCB4 has been identified as interacting with PsbS and potentially tAPX , the complete interaction network and its dynamic changes under different conditions remain to be fully characterized. Proximity-dependent labeling techniques (BioID, APEX) combined with proteomics could help map these interactions comprehensively.

  • Regulatory mechanisms: The transcriptional, translational, and post-translational regulation of LHCB4.2 under different environmental conditions needs further investigation. This includes the signaling pathways controlling its phosphorylation and how these intersect with other stress response mechanisms.

  • Evolution and diversification: Comparative genomic and functional studies across diverse plant species could reveal how LHCB4 isoforms evolved and diversified, potentially uncovering specialized adaptations to different ecological niches.

Addressing these gaps will require interdisciplinary approaches combining structural biology, advanced spectroscopy, functional genomics, and systems biology.

What emerging technologies might advance LHCB4.2 research and provide new insights?

Several cutting-edge technologies hold promise for advancing LHCB4.2 research:

  • Cryo-electron microscopy (Cryo-EM): High-resolution structural analysis of LHCB4.2 within intact PSII supercomplexes under different functional states could reveal conformational changes associated with photoprotection and stress responses.

  • Single-molecule tracking: Implementing techniques to visualize individual LHCB4.2 proteins within thylakoid membranes would provide unprecedented insights into their dynamic behavior, diffusion, and clustering during state transitions and NPQ.

  • CRISPR-Cas9 genome editing: Creating precise modifications (point mutations, domain swaps) in LHCB4.2 would allow fine-scale functional analysis beyond simple knockouts, potentially revealing the roles of specific amino acid residues or domains.

  • Synthetic biology approaches: Designing artificial LHCB4 variants with novel properties could help elucidate structure-function relationships and potentially lead to plants with enhanced photosynthetic efficiency or stress tolerance.

  • Advanced phenomics: High-throughput phenotyping under controlled and field conditions would help connect molecular-level understanding of LHCB4.2 to whole-plant performance, particularly under fluctuating environmental conditions.

  • Multi-omics integration: Combining transcriptomics, proteomics, metabolomics, and phenomics data from wild-type and mutant plants using machine learning approaches could reveal emergent properties and regulatory networks involving LHCB4.2.

These technological advances will likely transform our understanding of LHCB4.2 function in the coming years, potentially leading to applications in improving crop photosynthetic efficiency and stress tolerance.

What are the most common technical challenges when working with recombinant LHCB4.2 and how can they be overcome?

Researchers working with recombinant LHCB4.2 face several technical challenges:

  • Protein solubility: As a membrane protein, LHCB4.2 is inherently difficult to maintain in solution. This can be addressed by:

    • Using appropriate detergents (n-dodecyl β-D-maltoside or digitonin)

    • Employing amphipols or nanodiscs for membrane protein stabilization

    • Optimizing buffer conditions (pH, ionic strength, glycerol content)

  • Maintaining native structure: Ensuring that recombinant LHCB4.2 adopts its proper conformation with correctly bound pigments requires:

    • Co-expression with chlorophyll biosynthesis genes in suitable expression systems

    • Reconstitution protocols with purified pigments

    • Verification of spectroscopic properties compared to native protein

  • Antibody specificity: Commercial antibodies may cross-react with multiple LHCB4 isoforms. Solutions include:

    • Using validated isoform-specific antibodies when possible

    • Employing knockout lines as negative controls

    • Considering epitope-tagged versions for specific detection

  • Functional assays: Assessing the activity of isolated LHCB4.2 outside its native membrane environment presents challenges that can be addressed by:

    • Reconstitution into liposomes or nanodiscs

    • Developing in vitro energy transfer assays

    • Implementing complementation assays in knockout backgrounds

Recommended isolation protocol modifications for improving recombinant LHCB4.2 yield and quality:

ChallengeStandard ApproachImproved Method
Low expressionE. coli BL21(DE3)C41(DE3) strain designed for membrane proteins
Protein aggregationStandard lysis buffersAddition of glycerol (10%) and mild detergents
Pigment incorporationPost-expression additionCo-expression with chlorophyll synthesis genes
Purification yieldSingle affinity stepTandem affinity purification with size exclusion

These technical improvements can significantly enhance the quality and quantity of recombinant LHCB4.2 available for structural and functional studies.

How can researchers accurately measure and interpret LHCB4.2's contribution to energy transfer and dissipation?

Accurately measuring LHCB4.2's contribution to energy transfer and dissipation requires sophisticated biophysical approaches:

Time-Resolved Fluorescence Spectroscopy:

  • Implement ultrafast (femtosecond to picosecond) time-resolved measurements to track excitation energy flow

  • Compare wild-type and lhcb4.2 mutant samples to identify specific contributions

  • Analyze data using global and target analysis to resolve energy transfer components

  • Measure under different conditions (e.g., with/without NPQ induction)

Chlorophyll Fluorescence Analysis:

  • Determine PSII quantum efficiency (Fv/Fm) in wild-type and mutant plants

  • Measure functional antenna size using the t½ of fluorescence rise in DCMU-treated samples

  • Analyze fluorescence induction kinetics (OJIP transients)

  • Quantify NPQ components (qE, qT, qI) through recovery kinetics analysis

Interpretation Guidelines:

  • Direct vs. Indirect Effects: Distinguish between direct effects of LHCB4.2 absence and compensatory responses. Use comprehensive controls including single, double, and triple knockout combinations .

  • Quantitative Assessment: Employ parameters such as:

    • Energy transfer efficiency (ETE) between antenna and reaction center

    • Functional antenna size (σPSII)

    • Quantum yield of regulated (ΦNPQ) vs. non-regulated (ΦNO) energy dissipation

  • Condition-Specific Analysis: Measure under multiple conditions:

    • Different light intensities

    • Various spectral compositions

    • Fluctuating light regimes

    • Temperature variations

  • Integration with Structural Data: Correlate functional measurements with structural information about LHCB4.2's position and orientation within PSII supercomplexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.