Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP29.3, chloroplastic (LHCB4.3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LHCB4.3; At2g40100; F27I1.2; Chlorophyll a-b binding protein CP29.3, chloroplastic; LHCB4.3; LHCII protein 4.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-276
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LHCB4.3
Target Protein Sequence
RFGFSFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGKPAE YLQYDFDGLDQNLAKNVAGDIIGIIQESSEIKPTPFQPYTEVFGIQRFRECELIHGRWAM LGTLGAIAVEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNS ELDPEKRIYPGGYFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGPVS FLATFNN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Gene References Into Functions
  1. Research indicates that Lhcb4.1-.3 uniquely contributes to photosystem II antenna protein function, influencing photosystem II macro-organization and photoprotection. PMID: 21803939
Database Links

KEGG: ath:AT2G40100

STRING: 3702.AT2G40100.1

UniGene: At.24469

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is LHCB4.3 and how does it differ structurally from other LHCB4 isoforms?

LHCB4.3 (CP29.3) is one of three isoforms of the Lhcb4 light-harvesting complex in Arabidopsis thaliana. The key structural distinction of LHCB4.3 is that it lacks a large portion of the C-terminal domain that is characteristic of the Lhcb4.1 and Lhcb4.2 isoforms. This significant structural difference led to the suggestion that LHCB4.3 should be renamed as Lhcb8, classifying it as a distinct protein rather than merely an isoform . The mature LHCB4.3 protein comprises amino acids 30-276, as indicated by recombinant protein production data .

Unlike the other isoforms that share high sequence conservation, LHCB4.3's divergent structure suggests potentially different functional roles within the photosynthetic machinery, particularly in how it might interact with other components of photosystem II supercomplexes.

What is the expression pattern of LHCB4.3 compared to other LHCB4 isoforms?

LHCB4.3 is expressed at substantially lower levels than its paralogous genes under standard growth conditions. Quantitative analyses indicate that LHCB4.3 messenger RNA levels are approximately 20 times lower than those of LHCB4.1 and LHCB4.2 under control conditions . This significant difference in expression suggests a more specialized or condition-specific role for LHCB4.3.

The expression pattern comparison between the three isoforms can be summarized as follows:

IsoformRelative Expression LevelExpression Pattern
LHCB4.1HighConstitutive under normal conditions
LHCB4.2HighSimilar to LHCB4.1, constitutive
LHCB4.3Low (20× lower)Likely condition-specific

Mass spectrometry analysis of wild-type Arabidopsis has confirmed that LHCB4.1 and LHCB4.2 proteins are present in approximately equimolar amounts, while LHCB4.3 is detected at much lower levels .

What are the known functions of LHCB4.3 in photosynthetic processes?

While specific functions unique to LHCB4.3 remain incompletely characterized, the Lhcb4 family collectively plays crucial roles in several photosynthetic processes:

  • Light harvesting: As a chlorophyll a-b binding protein, LHCB4.3 participates in capturing light energy and transferring it to the photosystem II reaction center.

  • Macro-organization of photosystem II: Research on knockout mutants indicates that Lhcb4 proteins contribute to the structural organization of PSII supercomplexes .

  • Photosystem stability: The absence of Lhcb4 proteins affects the density of photosystem II complexes in thylakoid membranes .

The truncated C-terminal domain of LHCB4.3 likely modifies these functions compared to LHCB4.1 and LHCB4.2, potentially providing specialized adaptations to particular light conditions or stress responses, though direct experimental evidence specifically for LHCB4.3 is more limited than for the other isoforms.

How does LHCB4.3 contribute to photoprotection mechanisms?

Research on the Lhcb4 family indicates significant involvement in photoprotection, though LHCB4.3-specific contributions are less well characterized than those of LHCB4.1 and LHCB4.2. Knockout mutants lacking all three Lhcb4 isoforms (koLhcb4) demonstrate:

  • Reduced nonphotochemical quenching (NPQ): Lower NPQ activity compared to wild type or mutants retaining a single Lhcb4 isoform .

  • Increased photoinhibition sensitivity: Plants lacking all Lhcb4 isoforms show greater susceptibility to high light stress .

  • Altered energy dissipation: Lhcb4 has been identified as an interaction partner of PsbS, the pH-dependent trigger of energy-dependent quenching (qE) .

These findings suggest that while LHCB4.3 may participate in photoprotection mechanisms, its relatively low expression levels indicate it might play a more specialized role under specific stress conditions rather than contributing substantially to baseline photoprotection.

What methods are effective for generating and validating LHCB4.3 knockout mutants?

Based on successful approaches documented in the literature, the following methodological workflow is recommended for generating and validating LHCB4.3 knockout mutants:

  • T-DNA insertion line selection: Obtain T-DNA insertion lines targeting the LHCB4.3 locus (such as those available from repositories like the European Arabidopsis Stock Centre) .

  • PCR-based genotyping: Confirm homozygous T-DNA insertions using gene-specific and T-DNA border primers. For LHCB4.3, design primers that span the predicted insertion site .

  • RT-PCR validation: Perform reverse transcription PCR to confirm the absence of LHCB4.3 mRNA in the mutant lines .

  • Protein-level validation: Conduct Western blot analysis using specific antibodies against LHCB4.3, though cross-reactivity between isoforms can be challenging .

  • Mass spectrometry confirmation: For definitive protein-level validation, use mass spectrometry to identify isoform-specific peptides, particularly important for distinguishing between LHCB4 isoforms .

For comprehensive functional studies, researchers should consider generating combinations of knockout lines affecting multiple LHCB4 isoforms, as has been successfully done for LHCB4.1/4.2/4.3 triple mutants and various double mutant combinations .

What analytical techniques are most informative for characterizing LHCB4.3 function in photosystem II?

Several complementary techniques provide comprehensive insights into LHCB4.3 function:

  • Chlorophyll fluorescence analysis:

    • Measure PSII quantum efficiency (Fv/Fm)

    • Quantify nonphotochemical quenching (NPQ) kinetics and amplitude

    • Determine photosynthetic electron transport rates

    • Assess state transition kinetics, which are faster in Lhcb4-deficient plants

  • Photoinhibition assays:

    • Expose plants to high light stress and measure recovery kinetics

    • Quantify photosystem II damage using chlorophyll fluorescence parameters

  • Thylakoid membrane ultrastructure analysis:

    • Electron microscopy to assess grana stacking and thylakoid organization

    • Determine PSII complex density in thylakoid membranes

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interaction partners

    • Yeast two-hybrid analysis for direct protein interactions

  • Photosystem II supercomplex isolation and characterization:

    • Blue native gel electrophoresis to separate intact supercomplexes

    • Electron microscopy to determine structural organization of PSII-LHCII supercomplexes

How does the presence or absence of LHCB4.3 affect photosystem II supercomplex organization?

The organization of photosystem II supercomplexes is significantly influenced by the complement of light-harvesting proteins present. Though LHCB4.3-specific effects are less characterized than those of other isoforms, research on Lhcb4-deficient plants provides key insights:

These structural changes likely impact energy transfer efficiency and photoprotective mechanisms within the photosynthetic apparatus, highlighting the architectural role of LHCB4 proteins beyond their direct light-harvesting function.

What compensatory mechanisms occur in LHCB4.3-deficient plants?

Plants exhibit remarkable adaptability to the loss of individual light-harvesting components through various compensatory mechanisms:

These compensatory mechanisms highlight the plasticity of the photosynthetic apparatus and the complex regulatory networks that maintain photosynthetic efficiency even when individual components are missing.

How can researchers differentiate between the effects of different LHCB4 isoforms in experimental results?

Distinguishing the specific contributions of LHCB4.3 from other isoforms requires careful experimental design and analytical approaches:

  • Systematic mutant comparison strategy:

    • Analyze single knockout mutants (koLhcb4.1, koLhcb4.2, koLhcb4.3)

    • Examine double mutants (koLhcb4.1/4.2, koLhcb4.1/4.3, koLhcb4.2/4.3)

    • Compare with triple knockout (koLhcb4) and wild type

    • This comprehensive approach allows attribution of phenotypes to specific isoforms

  • Isoform-specific expression analysis:

    • Use RNA-seq or quantitative RT-PCR with isoform-specific primers to quantify transcript levels

    • Mass spectrometry-based proteomics to quantify protein isoform abundance ratios

  • Complementation studies:

    • Reintroduce individual isoforms into the triple knockout background

    • Express modified versions (e.g., domain swaps between isoforms) to identify functional regions

  • Condition-dependent phenotyping:

    • Test multiple environmental conditions (light intensity, temperature, stress)

    • LHCB4.3's lower expression suggests it may have condition-specific functions that only become apparent under particular circumstances

  • Statistical approaches:

    • Apply multivariate analysis to distinguish subtle isoform-specific effects

    • Use principal component analysis to identify patterns across multiple physiological parameters

What contradictions exist in the current understanding of LHCB4.3 function?

Several areas of uncertainty and apparent contradictions exist in our understanding of LHCB4.3 function:

  • Nomenclature and classification: The suggestion to reclassify LHCB4.3 as LHCB8 due to its structural differences from other LHCB4 isoforms creates inconsistency in the literature and raises questions about its evolutionary relationship to other light-harvesting proteins.

  • Phenotypic discrepancies: While some studies report minimal effects of Lhcb4 antisense lines under mild conditions , others show significant photoprotection impairment in knockout mutants. This contradiction may reflect differences in experimental conditions or genetic backgrounds.

  • Functional redundancy versus specificity: The low expression level of LHCB4.3 compared to other isoforms suggests a specialized function, yet clear LHCB4.3-specific phenotypes have been difficult to identify, raising questions about its unique physiological role.

  • Stress response contributions: While LHCB4 phosphorylation correlates with resistance to high light, cold, and water stress , the specific contribution of LHCB4.3 to these stress responses remains poorly characterized.

To resolve these contradictions, researchers should:

  • Consider developmental timing and tissue specificity in their experimental design

  • Examine multiple stress conditions to identify LHCB4.3-specific responses

  • Use high-resolution structural studies to clarify how the truncated C-terminal domain affects protein-protein interactions

  • Apply systems biology approaches to identify regulatory networks involving LHCB4.3

What are the most promising approaches for exploring LHCB4.3-specific functions?

Several cutting-edge approaches offer potential for elucidating LHCB4.3-specific functions:

These approaches, particularly when combined, offer promising avenues for resolving the specific functions of this enigmatic light-harvesting protein isoform.

How might LHCB4.3 research inform broader understanding of photosynthetic adaptation?

LHCB4.3 research has significant implications for understanding photosynthetic adaptation:

  • Evolutionary diversification: The structural divergence of LHCB4.3 from other LHCB4 isoforms provides insight into how gene duplication and functional specialization contribute to photosynthetic adaptation across diverse environments.

  • Stress resilience mechanisms: Understanding how the unique properties of LHCB4.3 contribute to photoprotection could reveal novel mechanisms for enhancing crop resilience to environmental stresses.

  • Photosystem assembly plasticity: Research on how photosystems accommodate structurally distinct proteins like LHCB4.3 illuminates the remarkable structural flexibility of these complexes.

  • Regulatory network complexity: The differential expression and potential condition-specific roles of LHCB4.3 highlight the sophisticated regulatory networks governing photosynthetic apparatus composition.

  • Cross-species comparison opportunities: Examining functional equivalents of LHCB4.3 across the plant kingdom, particularly comparing angiosperms like Arabidopsis with gymnosperms like Norway spruce that have evolved different light-harvesting strategies , provides insights into convergent and divergent evolutionary solutions to photosynthetic challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.