Recombinant Arabidopsis thaliana Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant cemA production typically involves heterologous expression in E. coli due to scalability and cost-efficiency. For A. thaliana homologs, emerging systems like the super-expression platform enable native post-translational modifications (e.g., N-glycosylation) .

Key Production Parameters

ParameterDetailSource
Expression VectorRecombinant plasmids optimized for E. coli or A. thaliana
YieldUp to 0.4 mg/g fresh weight in A. thaliana systems
StorageLyophilized powder; store at -20°C/-80°C
ReconstitutionDeionized water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Functional Insights from Proteomics and Interactomics

Proteomic studies of A. thaliana chloroplast envelopes identified cemA as part of a broader network regulating ion transport, lipid metabolism, and protein import .

Interaction Network Highlights

Interacting ProteinFunctionScoreSource
ycf4Photosystem I assembly0.990
ccsACytochrome c biogenesis0.970
clpP1ATP-dependent proteolysis0.968
TIC214Chloroplast protein import0.951

These interactions underscore cemA’s role in coordinating chloroplast activities, including photosynthesis and stress responses .

Applications in Biotechnology and Research

cemA research informs strategies for:

  • Carbon fixation optimization: Enhancing CO₂ uptake via proton extrusion mechanisms .

  • Protein complex studies: Assembly of photosynthetic apparatus (e.g., PSII cores) .

  • Biotechnology: Engineering chloroplast membranes for biofuel production or stress resilience .

Challenges and Future Directions

ChallengeSolutionSource
Low yield in heterologous systemsUse of A. thaliana super-expression systems for native modifications
Functional redundancyStructural studies to resolve cemA-specific mechanisms
Post-translational modificationsNative expression in A. thaliana to preserve N-glycosylation

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; ycf10; AtCg00530; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFLSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSFLEKF IQLEELFQLDEMIKEYPETNLQQFRLGIHKETIQFIKIHNEYNIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane and why is it important in Arabidopsis thaliana research?

The chloroplast envelope is a two-membrane system that surrounds plastids, including chloroplasts, in plant cells. Because of the integration of chloroplast metabolism within the plant cell, this envelope acts as a critical interface and is the site of many specific transport activities . In Arabidopsis thaliana, which has become the most widely studied plant model organism, the chloroplast envelope is particularly important because it contains a complex biochemical machinery essential for chloroplast development and function within the plant cell .

The envelope membranes host proteins involved in three main functions:

  • Ion and metabolite transport

  • Protein import machinery

  • Chloroplast lipid metabolism

Understanding these envelope proteins in Arabidopsis provides insight into fundamental chloroplast functions because Arabidopsis offers exceptional research advantages, including a small genome, abundant research tools, and extensive mutant collections that facilitate genetic and molecular studies .

What is cemA and what role does it play in chloroplast function?

The chloroplast envelope membrane protein A (cemA) is an integral membrane protein located in the chloroplast envelope. While not extensively characterized in the provided search results, cemA belongs to the class of highly hydrophobic proteins found in the inner envelope membrane of chloroplasts. These proteins typically contain multiple transmembrane (TM) domains and often function in transport processes.

Envelope membrane proteins with transport functions generally share common features:

  • Location in the inner envelope membrane

  • High hydrophobicity (4 or more transmembrane α-helices)

  • Low number of amino acid residues per transmembrane domain (Res/TM < 100)

  • High isoelectric point (pI > 8.8)

How does Arabidopsis thaliana serve as a model organism for chloroplast protein research?

Arabidopsis thaliana has become the preeminent model plant in modern biology despite its absence from the dinner table. Its value for chloroplast protein research stems from several key advantages:

  • Genetic resources: Arabidopsis has extensive mutant collections available from repositories like the Arabidopsis Biological Resource Center and the Nottingham Arabidopsis Stock Centre, which maintain >30,000 homozygous T-DNA insertional lines .

  • Transformation ease: Arabidopsis can be transformed using a simple dip method of flowering plants into Agrobacterium tumefaciens culture, making genetic manipulation relatively straightforward .

  • Genomic knowledge: Since the elucidation of its genome in 2000, enormous knowledge has accumulated, providing comprehensive genomic resources for protein studies .

  • Expression systems: Recently developed Arabidopsis-based super-expression systems enable preparative-scale production of homologous recombinant proteins, which is particularly valuable for studying complex membrane proteins native to the plant .

These advantages make Arabidopsis particularly suitable for studying chloroplast envelope membrane proteins, as researchers can leverage genetic tools to manipulate gene expression, tag proteins for localization studies, and produce recombinant proteins for biochemical and structural analyses .

What proteomics approaches are most effective for identifying novel chloroplast envelope membrane proteins in Arabidopsis?

For identifying novel chloroplast envelope membrane proteins, especially highly hydrophobic ones like cemA, multiple complementary proteomics approaches have proven most effective. Based on published research, a comprehensive strategy includes:

  • Preparation of highly purified envelope membranes: Developing a procedure to isolate envelope membranes with minimal contamination from other cellular components is critical. Research has shown that approximately 80% of proteins identified in purified envelope preparations are genuine envelope proteins .

  • Multiple protein extraction methods: Using different extraction techniques to retrieve proteins with varying hydrophobicity:

    • Chloroform/methanol extraction for highly hydrophobic proteins

    • Alkaline treatments for moderately associated proteins

    • Saline treatments for peripherally associated proteins

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS): Analyzing each envelope membrane subfraction separately to maximize protein identification .

  • Validation strategies: Confirming subcellular localization through multiple approaches:

    • Immunolocalization experiments

    • GFP fusion proteins

    • Protease protection assays

For example, one study combined highly purified membrane fractions, extraction of hydrophobic proteins with organic solvents, SDS/PAGE separation, and MS/MS analysis to identify 54 proteins, of which 27 were previously uncharacterized envelope proteins . This approach was particularly successful in identifying highly hydrophobic proteins with multiple α-helical transmembrane regions that are likely envelope transporters .

How can researchers optimize recombinant expression of chloroplast envelope membrane proteins like cemA in Arabidopsis systems?

Optimizing recombinant expression of chloroplast envelope membrane proteins requires addressing several challenges specific to membrane proteins. Based on recent developments in Arabidopsis expression systems:

  • Vector selection: Use specialized vectors designed for membrane protein expression in Arabidopsis. These typically include:

    • Strong promoters (e.g., 35S CaMV)

    • Appropriate targeting sequences for chloroplast localization

    • Epitope tags that don't interfere with membrane insertion

  • Expression system selection: Recently established Arabidopsis-based super-expression systems have shown promise for preparative-scale production of homologous recombinant proteins, including complex membrane proteins .

  • Growth conditions optimization:

    • Controlled light cycles

    • Optimized nutrient availability

    • Temperature regulation to prevent protein misfolding

  • Protein extraction strategy: For highly hydrophobic proteins with multiple transmembrane domains:

    • Use detergent screening to identify optimal solubilization conditions

    • Consider chloroform/methanol extraction which has proven effective for highly hydrophobic envelope proteins

  • Validation of functional expression:

    • Confirm correct localization to the chloroplast envelope

    • Verify protein folding and assembly

    • Test functional activity specific to the transport role

The Arabidopsis-based super-expression system has been successfully used for structural studies of multi-subunit integral membrane protein complexes, demonstrating its potential for challenging membrane proteins like cemA .

What are the challenges in determining structure-function relationships of chloroplast envelope transport proteins?

Determining structure-function relationships of chloroplast envelope transport proteins presents several significant challenges:

Recent advances in Arabidopsis expression systems offer promising approaches to overcome some of these challenges, particularly in obtaining sufficient quantities of recombinant protein for structural studies . Additionally, the correlation between physicochemical properties (pI > 8.8 and Res/TM < 100) and localization to the inner envelope membrane provides useful criteria for identifying potential transporters among newly discovered envelope proteins .

What extraction methods are most effective for isolating highly hydrophobic chloroplast envelope membrane proteins?

For isolating highly hydrophobic chloroplast envelope membrane proteins like cemA, research has demonstrated that different extraction methods yield complementary results. The most effective approaches include:

  • Chloroform/methanol (C/M) extraction: This method has proven particularly effective for highly hydrophobic proteins with multiple transmembrane domains.

    • Effectiveness: Successfully extracts proteins with as many as 13 transmembrane domains

    • Advantage: Enriches for the most hydrophobic membrane proteins

    • Limitation: May not extract all envelope proteins

  • Alkaline treatments: Effective for extracting proteins with fewer transmembrane domains or those with significant hydrophilic portions.

    • Typically uses sodium carbonate (pH 11.5)

    • Disrupts protein-protein interactions while maintaining membrane integrity

    • Releases peripheral proteins and some integral proteins

  • Saline treatments: Removes peripherally associated proteins.

    • Uses high salt concentrations (e.g., 1M NaCl)

    • Preserves most hydrophobic integral membrane proteins

    • Useful for distinguishing between integral and peripheral membrane proteins

The most comprehensive approach combines all three methods, analyzing each fraction separately. For example, in one study, liquid chromatography tandem mass spectrometry analyses on different envelope membrane subfractions led to the identification of more than 100 proteins . The C/M extraction method was particularly valuable for identifying highly hydrophobic inner envelope transporters with specific characteristics (Res/TM < 100 and pI > 8.8) .

How can researchers confirm the subcellular localization of newly identified envelope proteins?

Confirming the subcellular localization of newly identified envelope proteins requires multiple complementary approaches:

  • Immunolocalization experiments:

    • Generate specific antibodies against the target protein

    • Perform western blot analysis on subcellular fractions (envelope, stroma, thylakoid)

    • Conduct immunogold electron microscopy for precise localization

    For example, researchers validated the location of P60 and P45 proteins using immunodetection in the envelope fraction, confirming their absence in chloroplast extract, stroma, or thylakoid subfractions .

  • GFP fusion proteins:

    • Create fusion constructs between the target protein and fluorescent proteins

    • Express in Arabidopsis using transformation methods

    • Visualize localization using confocal microscopy

    • Compare with known envelope protein markers

  • Protease protection assays:

    • Treat isolated intact chloroplasts with proteases

    • Analyze which portions of the protein are protected (inside) vs. digested (outside)

    • Helps determine membrane topology and orientation

  • Subfractionation studies:

    • Separate inner and outer envelope membranes

    • Analyze protein distribution between fractions

    • For example, further experiments demonstrated that P60 and P45 are associated specifically with the inner membrane of the chloroplast envelope (subsequently named IEP60 and IEP45)

  • Bioinformatic approaches:

    • Analyze physiochemical properties (pI, hydrophobicity)

    • Examine for presence of chloroplast transit peptides

    • Use machine learning algorithms trained on known envelope proteins

A combination of these approaches is necessary, as demonstrated by research showing that validation of localization in the envelope of two phosphate transporters required multiple strategies to perform exhaustive identification .

What transformation methods are most suitable for expressing recombinant chloroplast envelope proteins in Arabidopsis?

Several transformation methods have been developed for expressing recombinant chloroplast envelope proteins in Arabidopsis, with varying efficiencies and applications:

  • Agrobacterium-mediated transformation:

    • Floral dip method: The most widely used approach involves dipping flowering Arabidopsis plants into Agrobacterium tumefaciens culture containing the construct of interest .

    • Advantages: Simple, requires minimal equipment, high efficiency

    • Limitations: Transformation is random, protein expression levels can vary

    • Best for: Initial characterization studies, localization experiments

  • Chloroplast transformation:

    • Direct transformation of the chloroplast genome

    • Advantages: Targeted integration, high expression levels, maternal inheritance

    • Limitations: Technically challenging in Arabidopsis compared to other plant species

    • Best for: High-level expression of envelope proteins encoded by chloroplast genome

  • Transient expression systems:

    • Involves infiltration of Arabidopsis leaves with Agrobacterium

    • Advantages: Rapid results (days rather than weeks)

    • Limitations: Lower expression than stable transformation, variable results

    • Best for: Quick screening of protein variants or initial functional tests

  • Arabidopsis-based super-expression system:

    • Recently established system for preparative-scale production

    • Successfully used for structural studies of multi-subunit integral membrane protein complexes

    • Advantages: High expression levels, native post-translational modifications

    • Best for: Obtaining sufficient quantities for biochemical and structural studies

For chloroplast envelope membrane proteins specifically, the Arabidopsis-based super-expression system has demonstrated particular promise, as it maintains the native cellular environment for proper folding and assembly of complex membrane proteins . This system represents an advancement over heterologous expression systems that may not provide the appropriate environment for plant membrane proteins.

How can researchers distinguish genuine chloroplast envelope proteins from contaminants in proteomics studies?

Distinguishing genuine chloroplast envelope proteins from contaminants in proteomics studies requires careful analysis using multiple criteria:

  • Purity assessment of subcellular fractions:

    • Monitor marker enzymes for different compartments

    • Assess contamination using western blotting with antibodies against known proteins from other compartments

    • For example, studies have confirmed sample quality by verifying absence of cross-contamination from extra-plastidial membranes and thylakoids

  • Protein characteristics analysis:

    • Evaluate transmembrane domain predictions

    • Analyze physicochemical properties

    • Research has identified specific criteria for inner envelope membrane transporters:

      • Presence of multiple α-helical transmembrane regions (≥4 TM domains)

      • Low number of amino acid residues per transmembrane domain (Res/TM < 100)

      • High isoelectric point (pI > 8.8)

  • Classification of identified proteins:

    • Group proteins based on predicted subcellular location:

      • Inner envelope membrane proteins

      • Outer envelope membrane proteins

      • Peripheral and stroma proteins

      • Proteins with unknown subcellular localization

  • Identification of contaminant patterns:

    • Peripheral and stroma proteins are typically soluble contaminants

    • These contaminants often cannot be visualized on stained SDS/PAGE gels (e.g., Rbcl)

  • Validation through complementary approaches:

    • Confirm localization through independent methods (immunolocalization, GFP fusion)

    • Research has shown approximately 80% of proteins identified in purified envelope preparations are genuine envelope proteins

By combining these approaches, researchers can achieve high confidence in identifying genuine chloroplast envelope proteins. For example, one study demonstrated that all known proteins identified through their chloroplast envelope proteomics approach were indeed chloroplastic proteins, confirming the absence of contamination from extra-plastidial membranes .

What bioinformatic tools are most useful for predicting functions of novel chloroplast envelope membrane proteins?

Predicting functions of novel chloroplast envelope membrane proteins requires a combination of specialized bioinformatic tools and analyses:

  • Sequence homology analysis:

    • BLAST searches against protein databases

    • Hidden Markov Model (HMM) profile searches for distant homologs

    • Domain identification using resources like Pfam, InterPro, and SMART

    • Analysis of conserved motifs specific to transporters or other functional classes

  • Structural prediction tools:

    • Transmembrane domain prediction (TMHMM, Phobius, HMMTOP)

    • Secondary structure prediction (PSIPRED, JPred)

    • 3D structure prediction (AlphaFold, RoseTTAFold)

    • Identification of channel-forming structures or transporter-specific folds

  • Functional classification databases:

    • Transporter Classification Database (TCDB)

    • Gene Ontology (GO) term prediction

    • Enzyme Commission (EC) number assignment for potential enzymatic activities

  • Contextual genomic analysis:

    • Co-expression analysis using Arabidopsis gene expression atlases

    • Identification of genes with similar expression patterns across tissues/conditions

    • Genomic context and gene neighborhood analysis across species

  • Integration of physicochemical properties:

    • For envelope transporters, combining Res/TM values with pI calculations

    • Research has shown strong correlation between location and combined values of pI and Res/TM

    • Proteins with both Res/TM < 100 and pI > 8.8 are highly likely to be inner membrane transporters

Using these approaches, researchers established a virtual plastid envelope integral protein database by mining the complete Arabidopsis genome based on features identified through proteomic studies, identifying more than 50 candidates for previously uncharacterized plastid envelope transporters . This combined proteomic and in silico approach provides a powerful means to predict the function of novel proteins and guide experimental validation.

How does N-terminal processing affect the localization and function of chloroplast envelope proteins?

N-terminal processing plays a critical role in the localization and function of chloroplast envelope proteins and provides important insights for recombinant protein design:

  • Transit peptide processing:

    • Most nuclear-encoded chloroplast proteins contain N-terminal transit peptides

    • These peptides direct proteins to chloroplasts and are cleaved upon import

    • Proteomics studies have identified N-alpha-acetylated proteins in the chloroplast envelope, indicating the accurate location of the N-terminus of mature proteins

    • This information is essential for designing recombinant constructs with proper targeting

  • Targeting signals within mature proteins:

    • After transit peptide removal, additional signals within the mature protein direct it to specific chloroplast compartments (envelope, stroma, thylakoid)

    • For envelope proteins, hydrophobic transmembrane domains often serve as membrane integration signals

    • The position and orientation of the first transmembrane domain is particularly important for correct membrane insertion

  • N-terminal modifications:

    • N-alpha-acetylation has been observed in chloroplast envelope proteins

    • These modifications may affect:

      • Protein stability and half-life

      • Protein-protein interactions

      • Protein-lipid interactions within the membrane

      • Transport activity for carrier proteins

  • Implications for recombinant protein expression:

    • Recombinant constructs must preserve correct processing sites

    • Epitope tags should be positioned to avoid interference with processing

    • Expression systems should maintain native processing machinery

Understanding N-terminal processing is crucial when designing expression constructs for recombinant envelope proteins. The identification of N-alpha-acetylated proteins provides valuable information about the actual mature N-terminus, which may differ from computational predictions . This knowledge helps ensure that recombinant proteins maintain their native structure and function when expressed in heterologous systems.

What are the future directions for research on Arabidopsis chloroplast envelope membrane proteins?

Future research on Arabidopsis chloroplast envelope membrane proteins, including cemA, is likely to focus on several promising directions:

  • Comprehensive functional characterization:

    • Nearly one-third of identified chloroplast envelope proteins have no known function

    • Systematic approaches to determine the roles of these uncharacterized proteins

    • Integration of proteomics data with genetic and biochemical analyses

  • Structural biology advancements:

    • Application of cryo-electron microscopy to determine structures of envelope complexes

    • Leveraging Arabidopsis-based super-expression systems for preparative-scale production of proteins for structural studies

    • Integration of AlphaFold predictions with experimental validation

  • Systems biology integration:

    • Understanding how envelope transporters coordinate chloroplast metabolism with cellular processes

    • Network analysis of transport functions and metabolic pathways

    • Computational modeling of metabolite flow across the envelope

  • Synthetic biology applications:

    • Engineering novel transport properties to enhance photosynthetic efficiency

    • Developing chloroplasts as bioproduction platforms

    • Creating synthetic regulatory circuits within chloroplasts

  • Evolutionary analyses:

    • Comparative studies of envelope proteins across plant species

    • Investigation of how envelope functions adapted during evolution of C3, C4, and CAM photosynthesis

    • Understanding the co-evolution of nuclear and chloroplast genomes in relation to envelope functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.