Recombinant Arabidopsis thaliana Copper transporter 1 (COPT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COPT1; At5g59030; K18B18.10; K18B18.2; Copper transporter 1; AtCOPT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
COPT1
Target Protein Sequence
MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWP GTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLV MLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCAC
Uniprot No.

Target Background

Function
A copper transporter crucial for copper uptake and transport in plant leaves. Essential for copper homeostasis and normal plant growth and development.
Gene References Into Functions
  1. Arabidopsis COPT1 overexpression (C1(OE)) in rice resulted in shortened roots under high copper conditions and iron deficiency. PMID: 28631167
  2. Copper transport activity differed between Col-0, COPT1-overexpressing (C1(OE)) seedlings, and the T-DNA COPT1 insertion mutant (copt1). C1(OE) exhibited a fivefold increase in Cu-induced K+ efflux at the root tip compared to Col-0. PMID: 23046313
  3. Overexpressing transgenic plants showed elevated endogenous copper levels and sensitivity to copper in the growth medium. PMID: 20335405
Database Links

KEGG: ath:AT5G59030

STRING: 3702.AT5G59030.1

UniGene: At.9700

Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the root apex, lateral root primordia, embryo, trichomes, guard cells and pollen grains.

Q&A

What is the basic structure of Arabidopsis thaliana COPT1?

COPT1 is a highly hydrophobic protein consisting of 169 amino acid residues with three putative transmembrane domains. The first 44 residues display significant homology to methionine- and histidine-rich copper binding domains found in bacterial copper binding proteins, including a copper transporting ATPase. This structural arrangement is critical for its function as a high-affinity copper transporter . COPT1 localizes primarily to the plasma membrane, with additional presence in the endoplasmic reticulum, as confirmed through studies using COPT1-GFP fusion proteins .

How does COPT1 function in copper transport?

COPT1 functions as a high-affinity copper transport protein that mediates copper uptake across cellular membranes. It was initially identified by complementation of a Saccharomyces cerevisiae mutant (ctr1-3) defective in high-affinity copper uptake, demonstrating its ability to transport copper ions . Research has confirmed that COPT1 participates in copper acquisition from the soil through plant root tips and plays a crucial role in systemic copper distribution throughout the plant . The transport activity depends on specific amino acid residues, particularly Lys159 in the C-terminal cytoplasmic tail, which has been identified as critical for copper acquisition but not for copper-mediated down-regulation of COPT1 .

How do researchers distinguish COPT1 from other copper transporters in Arabidopsis?

Researchers distinguish COPT1 from other copper transporters through several approaches:

  • Expression pattern analysis: COPT1 shows a distinct tissue-specific expression pattern, with high expression in embryos, trichomes, stomata, pollen, and root tips, as confirmed using reporter genes under the control of the COPT1 promoter .

  • Functional complementation studies: COPT1's specific ability to rescue copper transport-deficient yeast mutants demonstrates its unique high-affinity copper transport function .

  • Mutant phenotype characterization: COPT1 antisense or knockout plants exhibit specific phenotypes, including dramatically increased root length (reversed by copper addition), reduced steady-state copper levels in mature leaves, and pollen development defects .

  • Subcellular localization: COPT1 predominantly localizes to the plasma membrane and endoplasmic reticulum, which helps distinguish it from other copper transporters that may have different subcellular distributions .

What are the optimal methods for generating recombinant COPT1 for functional studies?

For generating functional recombinant COPT1, researchers should consider the following methodological approach:

  • Gene cloning strategies:

    • Clone the full-length COPT1 cDNA (coding for 169 amino acids) from Arabidopsis thaliana.

    • For functional studies, include appropriate tags (GFP, myc) at the C-terminus to avoid interfering with N-terminal metal-binding domains .

  • Expression systems:

    • Heterologous expression in yeast systems (particularly S. cerevisiae ctr1-3 mutants) provides a valuable platform for functional complementation assays .

    • For plant studies, use either transient expression in protoplasts or stable transformation via Agrobacterium-mediated methods .

  • Fusion protein considerations:

    • COPT1-GFP constructs are effective for localization studies and protein dynamics analysis .

    • COPT1-myc tags are preferable for immunoprecipitation and protein interaction studies .

  • Promoter selection:

    • For overexpression studies, the CaMV35S promoter has been successfully used .

    • For spatial expression studies, the native COPT1 promoter provides accurate tissue-specific expression patterns .

What techniques are effective for studying COPT1 protein dynamics and degradation?

Research has established several effective approaches for investigating COPT1 protein dynamics and degradation:

  • Fluorescent protein fusion analysis:

    • COPT1-GFP fusion proteins allow real-time monitoring of subcellular dynamics and degradation in response to copper treatments .

  • Proteasome inhibitor treatments:

    • MG132 treatment effectively blocks copper-induced degradation of COPT1, enabling the study of degradation mechanisms. Experimental data shows that MG132 largely abolishes copper-induced degradation of COPT1, implicating proteasomal degradation in copper homeostasis regulation .

  • Pharmacological approaches:

    • Treatments with vesicle trafficking inhibitors or V-ATPase inhibitors help distinguish between different degradation pathways. Studies have shown that these inhibitors do not alter COPT1-GFP subcellular dynamics, indicating that proteasomal degradation rather than vacuolar proteolysis regulates COPT1 levels .

  • Site-directed mutagenesis:

    • Mutation of specific residues, such as Lys159, allows investigation of the relationship between protein function and degradation mechanisms .

  • Co-immunoprecipitation analysis:

    • This technique effectively identifies COPT1-interacting proteins involved in degradation pathways, revealing that COPT1 cannot be ubiquitinated in the presence of excess copper and MG132 .

How can researchers accurately measure COPT1-mediated copper uptake and transport?

Accurate measurement of COPT1-mediated copper uptake and transport can be achieved through several complementary approaches:

  • Radioactive copper (64Cu) uptake assays:

    • These provide direct quantification of copper transport rates in seedlings, as demonstrated in studies showing decreased 64Cu uptake rates in COPT1 antisense plants .

  • Atomic absorption spectroscopy:

    • This technique enables precise measurement of steady-state copper levels in plant tissues, revealing reduced copper levels in mature leaves of COPT1 antisense plants .

  • Expression analysis of copper-responsive genes:

    • RT-qPCR measurement of genes known to be up or down-regulated by copper can serve as molecular indicators of cellular copper status. COPT1 antisense plants exhibit increased mRNA levels of genes that are down-regulated by copper .

  • Yeast complementation growth assays:

    • Growth restoration of copper transport-deficient yeast mutants expressing COPT1 provides functional evidence of transport activity. Studies show mutant yeast cells expressing COPT1 exhibit nearly wild-type behavior regarding growth on nonfermentable carbon sources and resistance to copper and iron starvation .

  • Copper sensitivity assays:

    • Measuring growth inhibition by copper-specific chelators (e.g., bathocuproine disulfonic acid) can reveal COPT1 functionality, with COPT1 antisense plants showing increased sensitivity to such chelators .

How does COPT1 function affect root development and architecture?

COPT1 plays a critical role in regulating root development in Arabidopsis:

  • Root elongation phenotype:

    • COPT1 antisense plants with decreased COPT1 expression display dramatically increased root length compared to wild-type plants .

    • This phenotype is completely and specifically reversed by copper addition, confirming that it results from copper deficiency rather than other metal imbalances .

  • Spatial expression pattern:

    • COPT1 is highly expressed in root tips, as demonstrated by reporter gene studies under the COPT1 promoter, suggesting localized copper uptake in these regions .

  • Copper acquisition mechanism:

    • COPT1 functions at the plasma membrane of root cells to transport copper from the apoplast into the cytoplasm, facilitating copper uptake from the soil .

  • Regulatory implications:

    • The specific reversal of the enhanced root length phenotype by copper supplementation indicates that copper levels, as regulated by COPT1, serve as a developmental signal in root growth control .

What is the relationship between COPT1 function and plant reproductive development?

COPT1 has significant impacts on reproductive development in Arabidopsis:

  • Pollen development:

    • COPT1 antisense plants exhibit specific pollen development defects that are reversible by copper supplementation, indicating a critical role for COPT1-mediated copper transport in male reproductive development .

    • COPT1 is highly expressed in pollen, suggesting targeted copper delivery to these tissues .

  • Flowering time regulation:

    • COPT1 overexpression affects flowering time in a photoperiod-dependent manner. Plants overexpressing COPT1 show differentially affected flowering times depending on the photoperiod, suggesting copper involvement in photoperiodic flowering control .

  • Circadian regulation:

    • COPT1 overexpression substantially reduces the expression of nuclear circadian clock genes CIRCADIAN CLOCK-ASSOCIATED1 (CCA1) and LATE ELONGATED HYPOCOTYL (LHY) .

    • Copper affects the amplitude and phase, but not the period, of CCA1 and LHY oscillations, along with reducing expression of circadian clock output genes .

How does COPT1-mediated copper transport interact with symbiotic nitrogen fixation in legumes?

While COPT1 has been primarily studied in Arabidopsis, research on copper transporters in legumes reveals important interactions with symbiotic nitrogen fixation:

  • Medicago truncatula COPT1 (MtCOPT1):

    • MtCOPT1 is a nodule-specific copper transporter that delivers copper for symbiotic nitrogen fixation .

    • It localizes to the plasma membrane of cells in the differentiation, interzone, and early fixation zones of nodules .

  • Functional impact on nitrogen fixation:

    • Mutation of MtCOPT1 results in diminished nitrogenase activity in nodules, likely as an indirect effect from the loss of a copper-dependent function .

    • Loss of MtCOPT1 affects cytochrome oxidase activity in bacteroids, demonstrating the importance of copper delivery for key symbiotic processes .

  • Growth and development effects:

    • MtCOPT1 mutants show reduced biomass production when plants obtain nitrogen exclusively from symbiotic nitrogen fixation, with this phenotype being mitigated by copper supplementation .

What mechanisms control COPT1 protein levels in response to copper status?

Several sophisticated mechanisms regulate COPT1 protein levels in response to cellular copper status:

  • Proteasomal degradation pathway:

    • COPT1 is rapidly degraded upon plant exposure to excess copper .

    • MG132 treatment (a proteasome inhibitor) largely abolishes copper-induced degradation of COPT1, indicating proteasomal involvement in COPT1 regulation .

    • Experimental evidence suggests that proteasomal degradation rather than vacuolar proteolysis is the primary mechanism for regulating copper transport to maintain copper homeostasis .

  • Ubiquitination-related regulation:

    • Co-immunoprecipitation analyses reveal that COPT1 cannot be ubiquitinated in the presence of excess copper and MG132 .

    • UBAC2 (ubiquitin-associated ER proteins) interact with COPT1 and plasma membrane-targeted members of the copper transporter family .

    • Disruption of UBAC2 genes significantly reduces COPT1 protein accumulation. Protein levels of COPT1-myc in ubac2a/2b mutants were less than 40% of those in control plants, despite similar transcript levels .

  • Structure-function relationships:

    • Site-directed mutagenesis identified Lys159 in the C-terminal cytoplasmic tail of COPT1 as critical for copper acquisition, but not for copper-mediated down-regulation .

    • This finding suggests separate structural determinants for transport function versus regulatory degradation.

How does COPT1 function influence iron homeostasis in plants?

Research has revealed complex interactions between COPT1-mediated copper transport and iron homeostasis:

  • Transcriptomic effects:

    • Deregulated copper transport in COPT1-overexpressing plants (COPT1 OE) significantly alters the expression of iron-related genes .

    • Genome-wide analysis revealed that several iron homeostasis genes are differentially expressed in COPT1 OE plants compared to wild type .

  • Iron uptake strategy components:

    • Expression of Strategy I components for iron uptake is affected in COPT1 OE seedlings. Key genes such as FRO2 (ferric reductase) and IRT1 (iron transporter) show altered expression patterns .

    • The table below summarizes some of the differentially expressed iron-related genes in COPT1 OE vs. WT seedlings:

GeneFunctionExpression Change in COPT1 OE
IRT1Iron transporterDecreased
FRO2Ferric reductaseAltered
FERIron deficiency regulatorAffected
bHLH38/39/100/101Iron uptake regulatorsIncreased
  • Hormonal interactions:

    • Hormone contents are affected in COPT1 OE seedlings, with jasmonic acid (JA) and indole acetic acid (IAA) levels decreased compared to wild type, while abscisic acid (ABA) levels remained unchanged .

    • These hormonal changes may mediate the cross-talk between copper and iron homeostasis, as plant hormones are involved in regulating the expression of iron deficiency-responsive genes .

  • Physiological consequences:

    • COPT1 OE seedlings show an altered response to iron deficiency, with local strategy I responses to iron deficiency being inhibited under copper excess conditions .

What are the transcriptional networks that regulate COPT1 expression?

While the search results don't provide comprehensive information on all transcriptional regulators of COPT1, they offer insights into several regulatory mechanisms:

  • Copper-responsive regulation:

    • COPT1 expression is regulated in response to cellular copper status, with mechanisms in place to adjust copper uptake according to plant needs .

  • SPL7 transcription factor:

    • The SPL7 (SQUAMOSA promoter binding protein-like 7) transcription factor is a key regulator of copper homeostasis in plants .

    • Certain iron deficiency responses are under the control of the copper-responsive SPL7 transcription factor, suggesting potential SPL7 involvement in COPT1 regulation .

  • Spatial and developmental regulation:

    • The specific expression pattern of COPT1 in embryos, trichomes, stomata, pollen, and root tips indicates sophisticated transcriptional regulation dependent on developmental stage and tissue type .

  • Circadian regulation:

    • COPT1 function affects the expression of circadian clock genes, but the search results don't specify whether COPT1 itself is under circadian control .

    • The interconnection with circadian rhythms suggests temporal regulation of copper transport, with spatiotemporal control of copper transport being essential for plant fitness .

How can COPT1 be utilized in biofortification strategies for micronutrient enhancement?

While the search results don't directly address biofortification applications, we can extrapolate research implications:

  • Controlled copper distribution:

    • Modulated expression of COPT1 could theoretically allow for targeted copper enrichment in edible plant tissues.

    • Understanding the tissue-specific expression pattern of COPT1 provides insights for directed biofortification strategies .

  • Nutritional quality improvement:

    • Copper is an essential micronutrient, and optimizing its transport could enhance nutritional value of crops.

    • The critical balance must be maintained, as both deficiency and excess of copper are detrimental to plant growth and development .

  • Cross-talk with other nutrients:

    • The demonstrated interactions between copper and iron homeostasis suggest that COPT1 manipulation could have broader impacts on multiple micronutrient profiles .

    • Any biofortification strategy would need to carefully consider these complex interactions to avoid unintended consequences on other essential mineral nutrients.

  • Methodological considerations:

    • Tissue-specific promoters rather than constitutive promoters would be preferable for biofortification applications to avoid copper toxicity.

    • The reversibility of COPT1-related phenotypes by copper supplementation suggests the possibility of inducible systems for controlled micronutrient enhancement .

What advanced imaging techniques can reveal COPT1 trafficking and membrane dynamics?

Based on current research approaches, several advanced imaging techniques could provide deeper insights into COPT1 dynamics:

  • Live-cell imaging with COPT1-GFP:

    • Real-time confocal microscopy of COPT1-GFP fusion proteins has already been used to study subcellular localization and copper-induced degradation .

    • Further applications could include:

      • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility within membranes

      • TIRF (Total Internal Reflection Fluorescence) microscopy to examine plasma membrane-specific dynamics

  • Super-resolution microscopy:

    • Techniques like STORM or PALM could provide nanoscale resolution of COPT1 organization in membrane microdomains.

    • These approaches would help determine if COPT1 forms clusters or associates with specific membrane regions during copper transport.

  • Correlative light and electron microscopy (CLEM):

    • Combining fluorescence imaging with electron microscopy could reveal the ultrastructural context of COPT1 localization.

    • This would provide insights into how COPT1 associates with specific membrane structures during trafficking and degradation.

  • Multi-color imaging for protein interactions:

    • Simultaneous imaging of COPT1 with ubiquitination machinery components could elucidate the spatiotemporal dynamics of degradation.

    • Co-visualization with other transporters (e.g., iron transporters) would help understand the physical basis of cross-talk between metal homeostasis systems .

How does COPT1 function relate to plant responses to biotic and abiotic stresses?

The search results provide limited direct information on COPT1's role in stress responses, but several connections can be inferred:

  • Oxidative stress management:

    • Copper is a redox-active metal that can facilitate the formation of reactive oxygen species (ROS), potentially causing damage to proteins, DNA, and lipids .

    • COPT1's regulation of copper homeostasis likely contributes to managing oxidative stress under various environmental conditions.

  • Circadian rhythm and stress adaptation:

    • Plants overexpressing COPT1 show compromised survival in the absence of environmental cycles such as light and temperature .

    • This suggests COPT1's involvement in circadian-regulated stress adaptation mechanisms, with proper spatiotemporal control of copper transport being crucial for plant fitness .

  • Cross-talk with hormonal stress responses:

    • Altered hormone levels (JA, IAA) in COPT1 OE plants suggest connections to stress signaling pathways .

    • The GO analysis of differentially regulated genes in COPT1 OE plants indicated overrepresentation of categories linked to oxidative stress and responses to abscisic acid (ABA) and cold stress .

  • Symbiotic interactions:

    • In legumes, copper transport through MtCOPT1 is essential for symbiotic nitrogen fixation, demonstrating COPT1's importance in plant-microbe interactions .

    • This suggests potential broader roles in other biotic interactions that remain to be explored.

What computational approaches can predict structure-function relationships in COPT1?

Based on current knowledge of COPT1 structure and function, several computational approaches would be valuable:

  • Homology modeling and molecular dynamics:

    • Using the known structural features (three transmembrane domains and metal-binding regions), homology models could be built based on related transporters .

    • Molecular dynamics simulations could reveal how copper binding induces conformational changes during transport.

  • Structure-based prediction of regulatory sites:

    • Computational analysis of the C-terminal region containing Lys159 (identified as critical for copper acquisition) could predict additional regulatory sites .

    • In silico mutagenesis could guide experimental efforts to identify residues important for ubiquitination and degradation.

  • Network analysis of COPT1 interactions:

    • Protein-protein interaction predictions could identify additional partners beyond the known UBAC2 interaction .

    • Integration of transcriptomic data from COPT1 OE plants could reveal broader regulatory networks connecting copper transport to other cellular processes .

  • Evolutionary analysis across species:

    • Comparative genomics between Arabidopsis COPT1 and homologs like MtCOPT1 could identify conserved functional domains .

    • Such analysis would be particularly valuable for extending findings from model systems to crop species.

What is the optimal protocol for generating functional COPT1 expression constructs?

Based on successful research approaches, the following protocol is recommended:

  • Cloning strategy:

    • Amplify the full COPT1 coding sequence (507 bp encoding 169 amino acids) from Arabidopsis cDNA using high-fidelity polymerase.

    • For C-terminal tagging, design primers that remove the stop codon and maintain reading frame with the tag sequence.

    • Include appropriate restriction sites compatible with your destination vector.

  • Vector selection:

    • For plant expression, pCAMBIA-based vectors with either native COPT1 promoter (for complementation) or CaMV35S promoter (for overexpression) have proven effective .

    • For protein localization studies, vectors containing C-terminal GFP fusion tags are recommended .

    • For protein interaction studies, vectors with epitope tags such as myc have been successfully employed .

  • Expression verification:

    • Confirm construct integrity by sequencing before transformation.

    • Verify expression levels in transgenic plants using RT-qPCR with COPT1-specific primers .

    • Validate protein expression using Western blotting with anti-GFP or anti-myc antibodies depending on your construct design .

  • Functional validation:

    • Test complementation ability in yeast ctr1-3 mutants defective in high-affinity copper uptake .

    • Assess phenotypic rescue in Arabidopsis copt1 mutant backgrounds .

How should researchers design experiments to investigate COPT1 interactions with the ubiquitin-proteasome system?

To effectively study COPT1 interactions with the ubiquitin-proteasome system, researchers should consider the following experimental design:

  • Protein stability assays:

    • Treat COPT1-GFP expressing plants with various copper concentrations (0-50 μM CuSO₄) for different time periods.

    • Include proteasome inhibitor treatments (e.g., 50 μM MG132 for 6-12 hours) as controls .

    • Monitor GFP fluorescence by confocal microscopy and quantify protein levels by Western blotting.

  • Ubiquitination detection:

    • Perform co-immunoprecipitation using anti-GFP or anti-myc antibodies from COPT1-tagged transgenic plants.

    • Analyze precipitates by Western blotting with anti-ubiquitin antibodies.

    • Include appropriate controls: copper treatments with and without MG132, and comparison of wild-type vs. ubiquitination pathway mutants .

  • Protein interaction studies:

    • Generate transgenic lines expressing COPT1-myc in both wild-type and ubac2a/2b mutant backgrounds.

    • Ensure transgene integration at the same genomic location to avoid position effects.

    • Compare protein levels by Western blotting and transcript levels by RT-qPCR to distinguish post-transcriptional regulation .

  • Site-directed mutagenesis:

    • Create lysine-to-arginine mutations at potential ubiquitination sites, especially Lys159 and other conserved lysines.

    • Assess the effects on protein stability and function in both yeast and plant systems .

  • Pharmacological approach:

    • Compare effects of different inhibitors (proteasome, vesicle trafficking, V-ATPase) to distinguish between degradation pathways.

    • Analyze COPT1-GFP subcellular dynamics under these treatments using time-lapse confocal microscopy .

How can researchers address variability in COPT1 expression levels between independent transgenic lines?

Variability in transgene expression is a common challenge that can be addressed through several methodological approaches:

  • Site-specific integration:

    • Use site-directed recombination systems (e.g., Cre/lox or FLP/FRT) to ensure integration at the same genomic location.

    • This approach was effective in comparative studies of COPT1-myc in different genetic backgrounds .

  • Statistical considerations:

    • Generate and analyze multiple independent transgenic lines (minimum 5-10) for each construct.

    • Perform statistical tests to ensure observed differences are not due to position effects.

  • Normalization strategies:

    • Always analyze transcript levels alongside protein levels to distinguish transcriptional from post-transcriptional effects.

    • Consider using internal controls such as constitutively expressed fluorescent proteins from the same construct.

  • Cross-validation approaches:

    • When comparing genetic backgrounds, generate isogenic lines through crossing rather than independent transformations.

    • For the most critical comparisons, create F1 progeny that differ only in the zygosity of the mutation of interest but contain the transgene integrated at the same genome site .

What are effective strategies for investigating COPT1 function under varying copper conditions without toxicity effects?

Working with copper presents challenges due to its essential yet potentially toxic nature. Effective strategies include:

  • Concentration range optimization:

    • Establish dose-response curves specific to your experimental system.

    • For Arabidopsis, typical working ranges include:

      • Deficiency: 0-0.1 μM CuSO₄

      • Sufficiency: 0.5-1 μM CuSO₄

      • Excess: 5-50 μM CuSO₄

    • Always include wild-type controls to distinguish COPT1-specific effects from general copper toxicity.

  • Chelator-based approaches:

    • Use specific copper chelators like bathocuproine disulfonic acid (BCS) to create copper deficiency without altering other metal homeostasis.

    • Perform parallel experiments with other metal chelators as controls .

  • Tissue-specific analysis:

    • Monitor copper effects in specific tissues where COPT1 is highly expressed (root tips, pollen, etc.).

    • This focused approach can reveal physiological responses before widespread toxicity occurs .

  • Short-term treatments:

    • For protein degradation studies, use short-term high copper exposures (e.g., 1-6 hours) to minimize secondary effects.

    • This approach effectively revealed COPT1 degradation dynamics without substantial toxicity .

  • Recovery experiments:

    • After copper treatments, transfer plants to standard media to assess reversibility of effects.

    • This approach successfully demonstrated the specific reversal of COPT1 antisense phenotypes by copper supplementation .

How can researchers differentiate direct COPT1-mediated effects from indirect consequences of altered copper homeostasis?

Distinguishing direct from indirect effects requires several complementary approaches:

  • Time-course experiments:

    • Monitor responses at multiple time points after altering COPT1 expression or copper availability.

    • Early responses are more likely to represent direct COPT1 effects, while later changes may reflect systemic adaptations.

  • Structure-function analysis:

    • Use site-directed mutagenesis to create COPT1 variants with altered transport activity but intact protein interactions.

    • For example, the Lys159 mutation affects copper acquisition but not copper-mediated down-regulation .

  • Comparative transcriptomics:

    • Compare gene expression profiles between COPT1 mutants and plants subjected to copper deficiency/excess through other means.

    • Genes affected in both scenarios likely represent indirect copper homeostasis responses .

  • Genetic interaction studies:

    • Create double mutants between COPT1 and components of other pathways (e.g., iron transporters, ubiquitination machinery).

    • Epistasis analysis can reveal regulatory relationships and separate direct from indirect effects .

  • Tissue-specific manipulations:

    • Use tissue-specific promoters to alter COPT1 expression only in certain cells.

    • This approach can help isolate local effects from systemic responses to altered copper status.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.