Recombinant Arabidopsis thaliana Copper transporter 2 (COPT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COPT2; At3g46900; T6H20.70; Copper transporter 2; AtCOPT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
COPT2
Target Protein Sequence
MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLI VIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIV AIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVC
Uniprot No.

Target Background

Function
Involved in copper transport.
Gene References Into Functions
  • The expression of SPL7 and its targets COPT2 and FSD1 exhibited differential regulation in various light signaling mutants. Under copper deficiency, target expression significantly decreased in continuous darkness. PMID: 26516126
  • Phenotypic and gene expression analyses of the copt2-1 line indicate a role for COPT2 in the interplay between copper, iron, and phosphate deficiency responses in Arabidopsis. PMID: 23487432
Database Links

KEGG: ath:AT3G46900

STRING: 3702.AT3G46900.1

UniGene: At.37005

Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in leaves and at lower levels in roots, stems and flowers.

Q&A

What is COPT2 and what is its basic function in Arabidopsis thaliana?

COPT2 is a high-affinity copper transport protein that functions primarily under copper and iron deficiencies in Arabidopsis thaliana. The protein consists of 158 amino acids and is a member of the CTR/COPT family with approximately 78% identity to COPT1 . COPT2 plays a critical role in copper acquisition and distribution throughout the plant, particularly under nutrient-limited conditions. The protein functions in the plasma membrane of specific plant cells where it facilitates copper uptake .

The structural analysis reveals that COPT2 contains three transmembrane domains (TMDs) with an external N-terminus and a cytosolic C-terminus. Key conserved features include the extracellular Met residue before TMD1, the MxxxM motif in TMD2, and the GxxxG motif in TMD3, all of which are essential for function based on studies of yeast homologs . Additionally, COPT2 contains a CxC motif in its C-terminal domain that may be involved in metal binding or protein-protein interactions .

How is COPT2 expression regulated in response to environmental conditions?

COPT2 expression is highly regulated by both copper and iron availability, showing a synergistic response pattern. The gene is upregulated under copper deficiency conditions, with COPT2 being the COPT family member whose expression is most strongly regulated by low copper . The COPT2 promoter region contains four GTAC motifs, which are likely involved in copper-responsive regulation through the SPL7 transcription factor pathway .

Interestingly, COPT2 expression also responds to iron deficiency in a partially FIT-dependent manner . The promoter contains a putative E-box consensus sequence that may mediate interaction with bHLH-type transcription factors such as the iron-responsive FIT protein . Under conditions of combined copper and iron deficiency, COPT2 expression shows distinctive patterns:

  • In roots, COPT2 expression increases dramatically under copper deficiency

  • Under iron deficiency alone, expression remains low in roots but is maintained at low levels in cotyledons

  • The expression in roots requires copper deficiency conditions and is not observed under iron deficiency when copper levels exceed 0.25 μM

  • Expression in cotyledons can be observed at higher copper levels under extended detection conditions

Additionally, phosphate starvation has been shown to diminish COPT2 expression, indicating complex nutrient-dependent regulation of this transporter .

Where is COPT2 protein localized in plant cells and tissues?

COPT2 is primarily localized to the plasma membrane of Arabidopsis cells, as confirmed by multiple experimental approaches. When COPT2 coding sequence was fused to GFP, the fusion protein displayed a signal on the cell surface that was absent from vacuoles, cytosol, and other subcellular compartments . This plasma membrane localization was further confirmed by colocalization with the FM4-64 marker, which localizes to the cell surface at low temperatures . Additional validation came from immunofluorescence labeling of transgenic Arabidopsis plants expressing COPT2-HA constructs, which showed signals restricted to the peripheral side of the cytoplasm when labeled with anti-HA antibodies .

In terms of tissue-specific expression, COPT2 shows a distinct spatial pattern. Analysis of transgenic Arabidopsis lines harboring a PCOPT2:GUS reporter gene revealed that COPT2 is expressed in most tissues of 7-day-old seedlings grown under copper-deficient conditions . In roots, expression is observed in:

  • The differentiation zone of primary roots

  • Lateral roots and root hairs

  • Primarily in the epidermis

Expression is notably absent from the elongation and meristematic zones of the root . In aerial tissues, COPT2 shows highest expression in vascular bundles and hydathodes of cotyledons . This spatial expression pattern suggests specialized roles in copper acquisition and distribution at specific sites within the plant.

How does COPT2 mediate cross-talk between copper and iron homeostasis pathways?

COPT2 serves as a critical molecular link in the cross-talk between copper and iron homeostasis in Arabidopsis. While the interconnection between copper and iron homeostasis is well-established in yeast and mammals, this relationship has been less understood in higher plants until recent research on COPT2 . The protein appears to function as an integrator of signals from both metal deficiency pathways.

Under iron deficiency conditions, COPT2 plays a dual role. First, it participates in the attenuation of copper deficiency responses driven by iron limitation, possibly as a mechanism to minimize further iron consumption . This suggests that COPT2 functions within a feedback system that balances the acquisition of both metals when one is limiting. Second, knockout studies of COPT2 (copt2-1) reveal that the absence of this transporter leads to increased low-phosphate responses, indicating that COPT2 also influences phosphate homeostasis in relation to metal availability .

The molecular mechanisms underlying this cross-talk likely involve coordinated transcriptional regulation. COPT2 expression responds to both copper and iron deficiencies through distinct but potentially overlapping regulatory pathways involving SPL7 (for copper) and FIT (for iron) . This dual regulation enables fine-tuned responses to varying nutrient conditions in the environment, allowing plants to prioritize resource allocation during multiple nutrient stresses.

What phenotypes are observed in copt2-1 knockout mutants under various nutrient deficiency conditions?

The copt2-1 knockout line, which contains a T-DNA insertion at -55bp relative to the translation start codon (separating the four putative copper regulatory GTAC motifs from the coding sequence), shows no detectable COPT2 expression under various copper availabilities . This knockout provides valuable insights into COPT2 function through its distinctive phenotypes.

Most notably, copt2-1 mutants exhibit increased resistance to simultaneous copper and iron deficiencies compared to wild-type plants . This resistance is manifested as:

  • Reduced leaf chlorosis under combined deficiency conditions

  • Improved maintenance of photosynthetic apparatus functionality

  • Altered root architecture responses to nutrient availability

Additionally, global expression analyses comparing copt2-1 versus wild-type Arabidopsis plants reveal that low-phosphate responses are enhanced in the mutant . This suggests that COPT2 normally suppresses phosphate deficiency responses, potentially as part of a nutrient prioritization mechanism.

The improved performance of copt2-1 under dual deficiency conditions is somewhat counterintuitive, as the loss of a high-affinity copper transporter might be expected to exacerbate copper deficiency symptoms. This paradox suggests that COPT2's role extends beyond simple copper uptake to include regulatory functions in nutrient homeostasis networks. The enhanced phosphate-deficiency responses in copt2-1 may contribute to its improved tolerance by activating alternative nutrient acquisition pathways that compensate for metal deficiencies.

How does COPT2 function differ from other members of the COPT family in Arabidopsis?

COPT2 shares significant sequence similarity with other members of the COPT family, particularly COPT1 (78% identity) , but exhibits distinctive functional characteristics that differentiate it from its paralogs. Unlike other COPT family members, COPT2 expression is most highly regulated by copper deficiency , indicating a specialized role in copper homeostasis under limiting conditions.

A key distinguishing feature of COPT2 is its responsiveness to both copper and iron deficiencies, with expression patterns showing synergistic responses to these metal limitations in roots . This dual responsiveness is not as pronounced in other COPT transporters, suggesting that COPT2 has evolved specialized functions in coordinating responses to multiple nutrient stresses.

COPT2's tissue-specific expression pattern also differs from other family members. While COPT1 is highly expressed in the root apex and pollen, COPT2 shows strong expression in the differentiation zone of roots but is absent from the elongation and meristematic zones . This complementary expression pattern suggests specialized roles for different COPT transporters in various tissues and developmental stages.

Furthermore, COPT2 uniquely influences phosphate homeostasis, as evidenced by the enhanced phosphate-deficiency responses in copt2-1 mutants . This connection to phosphate signaling has not been reported for other COPT family members, highlighting COPT2's role in integrating multiple nutrient sensing pathways.

What experimental approaches are most suitable for studying COPT2 function in planta?

Several complementary experimental approaches have proven effective for investigating COPT2 function in Arabidopsis:

  • Reporter gene analyses:

    • PCOPT2:GUS fusions allow visualization of spatial and temporal expression patterns in response to various nutrient conditions

    • The promoter region covering 1,248 bp upstream from the start codon provides sufficient regulatory elements for proper expression

    • Different GUS staining durations can reveal varying expression intensities in different tissues

  • Subcellular localization studies:

    • COPT2-GFP fusion proteins can determine subcellular localization

    • Colocalization with membrane markers like FM4-64 confirms plasma membrane targeting

    • Immunofluorescence with epitope-tagged COPT2 (e.g., COPT2-HA) provides additional validation

  • Knockout/knockdown approaches:

    • T-DNA insertion lines like copt2-1 are valuable for loss-of-function studies

    • CRISPR-Cas9 can generate precise mutations in functional domains

    • Artificial microRNA approaches offer an alternative for reducing COPT2 expression

  • Nutrient deficiency experiments:

    • Compare plant responses under four conditions: +Fe+Cu, +Fe-Cu, -Fe+Cu, and -Fe-Cu media

    • Use 1/2 MS medium as a base, supplementing with 10 μM CuSO₄ for copper-sufficient conditions

    • For iron deficiency, omit iron from media and add 300 μM ferrozine (a specific Fe²⁺ chelator)

    • Monitor phenotypes including chlorosis, root architecture, and photosynthetic parameters

  • Global expression analyses:

    • RNA-seq or microarray comparisons between wild-type and copt2 mutants under various nutrient conditions reveal downstream affected pathways

    • qRT-PCR validation of key genes identified in global analyses

    • Focus on genes involved in copper, iron, and phosphate homeostasis networks

These approaches should be combined for comprehensive understanding of COPT2 function. For example, phenotypic analyses of copt2 mutants should be complemented with molecular studies of affected pathways, and expression studies should be validated with protein localization and functional assays.

How can researchers effectively design experiments to study COPT2's role in nutrient cross-talk?

Designing experiments to investigate COPT2's role in nutrient cross-talk requires carefully controlled nutrient conditions and multifaceted analysis approaches. The following experimental design considerations are recommended:

  • Nutrient matrix experimental design:

    • Implement a factorial design varying copper, iron, and phosphate concentrations

    • Include sufficient biological replicates (minimum n=4) for statistical power

    • Example matrix design:

    ConditionCopper (μM)Iron (μM)Phosphate (mM)
    Control1.0501.25
    -Cu0501.25
    -Fe1.00 + ferrozine1.25
    -P1.0500.0625
    -Cu-Fe00 + ferrozine1.25
    -Cu-P0500.0625
    -Fe-P1.00 + ferrozine0.0625
    -Cu-Fe-P00 + ferrozine0.0625
  • Genetic materials:

    • Compare wild-type, copt2-1, and complementation lines expressing COPT2 under native promoter

    • Include SPL7 mutants (copper signaling) and FIT mutants (iron signaling) to dissect regulatory pathways

    • Consider double mutants with other transporters or regulatory components

    • Use phosphate signaling mutants (e.g., phr1 phl1) to investigate COPT2-phosphate connections

  • Time-course analyses:

    • Examine responses at multiple time points (e.g., 3, 7, 14 days) after transfer to deficiency conditions

    • This reveals temporal dynamics of cross-talk mechanisms

    • Early responses may indicate direct regulatory connections while later responses may reflect secondary adaptations

  • Multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics analyses

    • This comprehensive approach can identify novel components in nutrient cross-talk networks

    • Focus on metabolites at the intersection of metal and phosphate homeostasis

  • Data integration:

    • Employ network analysis tools to integrate multi-omics datasets

    • Use Gene Ontology enrichment and pathway analyses to identify functional categories affected by COPT2

    • Apply machine learning approaches to identify patterns in complex nutrient-responsive datasets

By systematically varying multiple nutrients and analyzing responses at different levels (gene expression, protein abundance, metabolite profiles), researchers can elucidate the complex mechanisms by which COPT2 mediates nutrient cross-talk in Arabidopsis.

How should contradictory findings regarding COPT2 function be reconciled in the scientific literature?

When faced with contradictory findings regarding COPT2 function in scientific literature, researchers should consider the following systematic approach to reconcile discrepancies:

  • Examine experimental conditions:

    • Subtle differences in growth conditions can significantly impact COPT2 function

    • Key parameters to compare include:

      • Base media composition (MS, hydroponics, soil)

      • Light intensity and photoperiod

      • Plant age at analysis

      • Specific concentrations and chemical forms of nutrients

    • For example, COPT2 expression in roots shows different patterns depending on precise copper concentrations, with expression not observed under iron deficiency when copper exceeds 0.25 μM

  • Consider genetic background effects:

    • Ecotype differences (Col-0 vs. other accessions) may influence COPT2 function

    • The presence of mutations in related pathways could mask or enhance COPT2 phenotypes

    • Confirm genotypes through sequencing of key regions including the COPT2 promoter

  • Evaluate methodological differences:

    • Different detection methods (qRT-PCR vs. RNA-seq vs. reporter genes) have varying sensitivities

    • For example, COPT2 expression in cotyledons under iron deficiency requires overnight GUS staining for detection, indicating low expression levels that might be missed in less sensitive assays

    • Protein detection methods may vary in specificity and sensitivity

  • Analyze tissue-specific effects:

    • COPT2 shows distinct expression patterns in different tissues

    • Contradictory findings may result from analyzing different tissues or developmental stages

    • Whole-plant analyses may mask tissue-specific responses

  • Design crucial experiments to resolve contradictions:

    • Directly compare conditions from contradictory studies in parallel experiments

    • Use multiple, complementary approaches to measure the same parameters

    • Consider collaborations between labs reporting different results

When presenting reconciled interpretations, researchers should acknowledge experimental limitations and propose unified models that account for context-dependent COPT2 functions. This approach not only resolves contradictions but also advances understanding of the complex regulatory networks governing nutrient homeostasis in plants.

What statistical approaches are most appropriate for analyzing COPT2-related experimental data?

When analyzing COPT2-related experimental data, researchers should employ appropriate statistical methods that address the specific characteristics of nutrient deficiency experiments. The following approaches are recommended:

  • For gene expression analyses:

    • Two-way or three-way ANOVA for factorial designs examining interactions between multiple nutrients (Cu, Fe, P)

    • Include appropriate post-hoc tests (Tukey's HSD or Bonferroni) for multiple comparisons

    • For qRT-PCR data, use the ΔΔCt method with appropriate reference genes validated for stability under nutrient deficiency conditions

    • Consider non-parametric alternatives (Kruskal-Wallis) when data violate normality assumptions

  • For -omics data analysis:

    • Apply appropriate normalization methods (e.g., TMM for RNA-seq)

    • Use false discovery rate (FDR) corrections for multiple testing

    • Employ Gene Set Enrichment Analysis (GSEA) to identify coordinated changes in pathways

    • Consider time-series analysis methods for temporal experiments

  • For integrating multiple data types:

    • Correlation networks to identify relationships between transcripts, proteins, and metabolites

    • Canonical correlation analysis (CCA) to relate expression profiles to phenotypic data

    • Structural equation modeling to test hypothesized causal relationships

  • Sample size considerations:

    • Conduct power analysis to determine appropriate sample sizes

    • For expression studies comparing wild-type and copt2-1 under multiple nutrient conditions, minimum n=3 biological replicates is essential, with n=4-6 recommended for greater statistical power

By applying these rigorous statistical approaches, researchers can more confidently interpret complex datasets related to COPT2 function and nutrient cross-talk, leading to more robust and reproducible findings in the field.

How can researchers distinguish direct versus indirect effects of COPT2 on plant physiology?

Distinguishing direct versus indirect effects of COPT2 on plant physiology represents a significant challenge in research. The following methodological approaches can help researchers differentiate between these effects:

  • Temporal analyses:

    • Implement time-course experiments after transferring plants to deficiency conditions

    • Early responses (hours to 1-2 days) are more likely to represent direct COPT2 effects

    • Later responses (several days to weeks) may reflect secondary adaptation mechanisms

    • Example experimental design:

      • Transfer plants to Cu/Fe deficient media and sample at 6h, 12h, 24h, 48h, 7d

      • Analyze COPT2 expression alongside potential direct targets and downstream pathways

      • Plot temporal progression of responses to identify primary vs. secondary effects

  • Inducible expression systems:

    • Use chemically-inducible promoters (e.g., estradiol-inducible) to control COPT2 expression

    • Monitor immediate responses following induction

    • Compare rapid transcriptional changes (within hours) to identify potential direct targets

    • This approach minimizes developmental or long-term adaptation effects

  • Direct binding studies:

    • For protein-protein interactions: use co-immunoprecipitation, yeast two-hybrid, or bimolecular fluorescence complementation

    • For protein-DNA interactions (if COPT2 has regulatory functions): chromatin immunoprecipitation (ChIP)

    • In vitro transport assays with purified protein in proteoliposomes to confirm direct transport function

  • Genetic approaches:

    • Create double/triple mutants with components of potential downstream pathways

    • Epistasis analysis can reveal dependency relationships between COPT2 and other factors

    • Rescue experiments with tissue-specific expression can identify sites of direct action

  • Metabolic profiling:

    • Focus on immediate metabolites affected by copper and iron transport

    • Monitor changes in copper, iron, and phosphate levels in different cellular compartments using appropriate biosensors

    • Changes in metal content of cellular compartments are likely direct effects of COPT2 transport activity

A comparative table illustrating potential direct vs. indirect effects of COPT2 can guide experimental design:

ResponseTime ScaleLikely Relationship to COPT2Experimental Approach
Cellular Cu uptakeMinutes to hoursDirect effectRadioactive Cu⁶⁴ uptake assays
Cu-dependent enzyme activityHoursDirect or indirectEnzymatic activity assays
Fe-homeostasis gene expressionHours to daysPotentially directqRT-PCR after inducible COPT2 expression
Phosphate starvation responsesDaysLikely indirectTime-course global expression analysis
Chlorosis symptomsDays to weeksIndirectPhenotypic analysis with tissue-specific complementation

By combining these approaches and carefully designing experiments that can distinguish temporal and causal relationships, researchers can better delineate the direct functions of COPT2 from its indirect effects on broader plant physiology.

What are the most promising biotechnological applications of COPT2 research for crop improvement?

Research on COPT2 opens several promising avenues for crop improvement, particularly in addressing nutrient deficiency challenges in agriculture. The following biotechnological applications represent high-potential areas for translating COPT2 research into practical solutions:

  • Engineering nutrient efficiency:

    • Modifying COPT2 expression to enhance crop growth under iron-limited conditions

    • The knockout of COPT2 (copt2-1) leads to increased resistance to simultaneous copper and iron deficiencies, suggesting that targeted downregulation might improve crop performance on nutrient-poor soils

    • Engineering COPT2 promoters to optimize nutrient uptake timing and tissue specificity

  • Biofortification strategies:

    • Enhancing micronutrient content in edible tissues through targeted COPT2 expression

    • Exploiting COPT2's role in copper and iron homeostasis to develop crops with improved nutritional value

    • Combining COPT2 modifications with other transporters for synergistic biofortification effects

  • Stress tolerance improvement:

    • Leveraging COPT2's function in reducing leaf chlorosis and maintaining photosynthetic apparatus under nutrient stress

    • Engineering stress-responsive COPT2 expression to enhance crop resilience

    • Developing varieties with modified COPT2 that respond more efficiently to fluctuating nutrient availability

  • Phosphate utilization efficiency:

    • Exploiting the connection between COPT2 and phosphate responses to enhance phosphorus use efficiency

    • Global expression analyses of copt2-1 plants show enhanced low-phosphate responses, suggesting potential applications in improving crop growth on phosphate-limited soils

    • This is particularly valuable considering phosphorus is a limited and non-renewable agricultural resource

  • Precision agriculture applications:

    • Developing COPT2 expression-based biosensors to monitor soil nutrient status

    • Creating diagnostic tools for early detection of nutrient deficiencies in crops

    • Using COPT2 knowledge to optimize fertilizer application timing and composition

These applications are especially relevant given the global challenges of nutrient deficiency in crops. Iron deficiency affects approximately 30% of the world's soils, particularly calcareous and alkaline soils, while phosphate resources are rapidly depleting. The unique position of COPT2 at the intersection of copper, iron, and phosphate homeostasis makes it a valuable target for developing crops with improved nutrient efficiency and stress tolerance.

What are the key unanswered questions regarding COPT2 function in Arabidopsis and other plant species?

Despite significant advances in understanding COPT2 function, several critical questions remain unresolved:

  • Molecular mechanisms of nutrient sensing:

    • How does COPT2 integrate signals from copper, iron, and phosphate sensing pathways?

    • What are the upstream sensors that regulate COPT2 expression under various deficiency conditions?

    • Which transcription factors besides SPL7 and FIT regulate COPT2 expression?

  • Protein-level regulation:

    • Are there post-translational modifications that regulate COPT2 activity?

    • How is COPT2 protein stability and turnover regulated under changing nutrient conditions?

    • Do protein-protein interactions modulate COPT2 function in different cellular contexts?

  • Transport mechanisms:

    • What is the precise stoichiometry and kinetics of COPT2-mediated copper transport?

    • Does COPT2 interact with other metal transporters to coordinate nutrient uptake?

    • Are there secondary substrates or transport activities beyond copper uptake?

  • Evolutionary conservation:

    • How conserved is COPT2 function across different plant species, especially crops?

    • Has COPT2 evolved different regulatory mechanisms in plants adapted to various nutrient environments?

    • Can functional knowledge from Arabidopsis COPT2 be directly translated to crop COPT2 orthologs?

  • Whole-plant integration:

    • How does root-expressed COPT2 communicate with aerial tissues to coordinate systemic responses?

    • What role does COPT2 play in source-sink relationships for copper distribution?

    • How does COPT2 function change throughout plant development and under various environmental stresses?

Addressing these questions will require innovative experimental approaches including:

  • CRISPR-based genome editing to create precise modifications in COPT2 functional domains

  • Single-cell transcriptomics to understand cell-type specific COPT2 functions

  • Advanced imaging techniques to track metal movement in planta

  • Comparative studies across multiple plant species to understand evolutionary conservation

These unresolved questions represent exciting opportunities for future research that may lead to fundamental insights into plant nutrient homeostasis networks and novel applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.