Recombinant Arabidopsis thaliana Copper transporter 4 (COPT4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements, and we will prioritize fulfilling them.
Synonyms
COPT4; At2g37925; T8P21.17; Copper transporter 4; AtCOPT4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
COPT4
Target Protein Sequence
MLSSKNVVVVEAWNTTTTTQTQTPHRPSLLHPTFYWGYNCQVLFSGWPGSDRGMYALALI FVFFLAFLAEWLARCSDASSIKQGADKLAKVAFRTAMYTVKSGFSYLVILAVVSFNGGVF LAAIFGHALGFAVFRGRAFRNRDIQ
Uniprot No.

Target Background

Function
Involved in copper transport.
Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in roots and at lower levels in leaves, stems and flowers.

Q&A

What is the optimal expression system for recombinant COPT4 production?

For recombinant COPT4 production, Agrobacterium-mediated transformation has proven most effective for in planta studies. Similar to the approach used for expansin expression in Arabidopsis, COPT4 can be effectively transformed using Agrobacterium tumefaciens GV3101 pSOUP+ cells followed by the floral dip method . For protein purification purposes, E. coli-based systems (BL21(DE3) with pET vectors) can be employed for initial studies, though membrane protein solubility challenges often necessitate using eukaryotic systems like Pichia pastoris for functional studies.

When selecting an expression system, consider the following factors:

  • Research goal (in vivo localization vs. protein purification)

  • Required post-translational modifications

  • Necessary protein yield

  • Downstream applications (structural studies vs. functional assays)

What are the standard protocols for subcellular localization studies of COPT4?

For subcellular localization studies of COPT4, fluorescent protein tagging combined with confocal microscopy is the standard approach. Similar to the methodology used for expansin localization , researchers should:

  • Generate C- or N-terminal fluorescent protein fusions (GFP, YFP, or mCherry)

  • Use the native COPT4 promoter to maintain physiological expression patterns

  • Transform Arabidopsis using Agrobacterium-mediated floral dip method

  • Select transgenic lines based on fluorescence screening

  • Examine expression patterns using confocal microscopy

When analyzing localization patterns, it's important to distinguish between cell types and developmental stages, as expression patterns may vary significantly as observed with expansins in Arabidopsis shoots . Additionally, co-localization with established membrane markers can confirm plasma membrane or organelle targeting.

How can researchers generate and validate COPT4 knockout/knockdown lines?

To generate COPT4 knockout mutants, CRISPR/Cas9 technology has proven highly effective in Arabidopsis, as demonstrated with expansin genes . The recommended approach includes:

  • Design guide RNAs targeting the early exons of COPT4

  • Construct CRISPR/Cas9 vectors with appropriate promoters

  • Transform Arabidopsis via Agrobacterium-mediated floral dip

  • Screen T1 transformants and propagate to T2 generation

  • Select non-fluorescent T2 lines (segregated out T-DNA)

  • Sequence for insertions/deletions using gene-specific primers

  • Validate knockouts at the protein level via Western blot

GenerationScreening MethodExpected Outcome
T1Fluorescence selectionIdentification of transformants
T2Non-fluorescent selectionT-DNA segregation
T2/T3PCR + sequencingConfirmation of indels
T3Homozygosity screeningStable knockout lines

RT-qPCR and Western blot analysis should be performed to confirm the absence of functional COPT4. Complementation with the wild-type gene should rescue any phenotypes to confirm gene-phenotype relationships.

What methods are most effective for studying COPT4 regulation in response to copper levels?

To study COPT4 regulation in response to copper levels, a multi-faceted approach is recommended:

  • Transcriptional regulation: Use promoter:GUS or promoter:LUC fusions to visualize expression patterns under varying copper concentrations

  • Protein level regulation: Develop antibodies against COPT4 or use epitope-tagged versions (if function is maintained)

  • Post-translational modifications: Use phosphoproteomic approaches to identify regulatory modifications

Experimental design should include:

  • Copper deficiency treatment (using chelators like BCS)

  • Normal copper conditions

  • Excess copper treatments

  • Time-course analyses to capture rapid regulatory responses

  • Tissue-specific analysis similar to expansin expression studies

Such approaches will help identify copper-responsive elements in the COPT4 promoter and potential post-translational regulatory mechanisms.

How does COPT4 function differ from other Arabidopsis copper transporters?

Understanding functional differentiation between COPT family members requires comparative analysis. Recommended approaches include:

  • Phylogenetic analysis: Compare COPT family sequences across species to identify conserved and divergent regions

  • Expression pattern analysis: Compare tissue-specific and developmental expression patterns of COPT family members

  • Complementation studies: Test if COPT4 can complement other copt mutants

  • Transport kinetics: Determine copper affinity and transport rates in heterologous systems

Similar to the differential expression and localization patterns observed with expansin family members in Arabidopsis , COPT transporters likely have distinct but overlapping functions. For example, while some COPT members may be expressed in roots, others might show preferential expression in shoots or reproductive tissues, enabling coordination of copper distribution throughout the plant.

What structural features determine COPT4 substrate specificity and transport mechanism?

Determining the structural basis of COPT4 function requires advanced structural biology approaches:

  • Homology modeling: Based on crystal structures of related transporters

  • Site-directed mutagenesis: Target conserved methionine-rich motifs (Mets motifs) thought to form the copper translocation pathway

  • Protein purification and reconstitution: Establish protocols for membrane protein purification and functional reconstitution

  • Cryo-EM analysis: For high-resolution structural determination

Critical residues to investigate include:

  • Conserved methionine residues in transmembrane domains

  • N-terminal metal binding domains

  • Potential phosphorylation sites that may regulate activity

Similar to receptor binding studies in other systems , identifying key domains involved in substrate recognition and transport will provide insights into COPT4's mechanism of action.

How can researchers resolve contradictory data on COPT4 localization and function?

Resolving contradictory data requires systematic investigation of variables that might affect experimental outcomes:

  • Epitope tag interference: Compare N- and C-terminal tags, and untagged versions

  • Growth conditions: Systematically vary copper levels, light conditions, and other environmental factors

  • Developmental timing: Examine expression at different developmental stages

  • Tissue-specific effects: Analyze cell-type specific expression using techniques like FACS-based isolation

  • Genetic background effects: Test in multiple Arabidopsis ecotypes

VariableExperimental ApproachAnalysis Method
Tag positionGenerate multiple tagged constructsConfocal microscopy, Western blot
Environmental conditionsVaried growth media and conditionsRT-qPCR, phenotypic analysis
Developmental timingTime-course samplingRT-qPCR, microscopy
Tissue specificityCell-type specific promotersConfocal imaging
Genetic backgroundTransform multiple ecotypesComparative phenotyping

By systematically controlling these variables, researchers can identify factors contributing to seemingly contradictory results, similar to approaches used to understand differential expansin localization patterns .

How does COPT4 interact with other components of the copper homeostasis network?

Understanding COPT4's role within the broader copper homeostasis network requires integrative approaches:

  • Interactome analysis: Use yeast two-hybrid, split-ubiquitin systems, or co-immunoprecipitation followed by mass spectrometry

  • Genetic interaction studies: Generate double/triple mutants with other copper homeostasis genes

  • Transcriptome analysis: Compare wild-type and copt4 mutant transcriptomes under varying copper conditions

  • Metabolome analysis: Identify metabolic changes in copt4 mutants

This approach is conceptually similar to understanding epistatic relationships between photomorphogenic mutants in Arabidopsis , where double mutant analysis helped reveal pathway hierarchies.

Key interactions to investigate include:

  • Other COPT family members (functional redundancy)

  • Copper chaperones

  • Copper-responsive transcription factors

  • Downstream copper-dependent enzymes

What are effective strategies for overcoming expression challenges with recombinant COPT4?

Membrane proteins like COPT4 present significant expression challenges. Effective strategies include:

  • Codon optimization: Adapt the COPT4 coding sequence to the expression host

  • Expression tags: Test various solubility-enhancing tags (MBP, SUMO, TrxA)

  • Expression conditions: Systematically optimize temperature, inducer concentration, and expression duration

  • Solubilization screening: Test different detergents for optimal extraction

For in planta expression, consider inducible expression systems, similar to the Dex-inducible system used for expansin expression , which allows control over expression timing and level to prevent potential toxicity from overexpression.

How can researchers develop reliable functional assays for COPT4 activity?

Functional characterization of COPT4 requires sensitive and specific assays:

  • Heterologous expression systems: Yeast complementation assays using copper-transport deficient yeast strains

  • Radioisotope uptake: Direct measurement of 64Cu transport in membrane vesicles

  • Copper-responsive fluorescent sensors: Real-time monitoring of copper transport in live cells

  • Electrophysiological approaches: Patch-clamp analysis of COPT4-expressing cells or proteoliposomes

Each approach has advantages and limitations that should be considered based on research questions:

Assay TypeAdvantagesLimitationsBest For
Yeast complementationIn vivo relevanceIndirect measurementInitial functional validation
Radioisotope uptakeDirect measurementSafety concerns, endpoint assayQuantitative transport kinetics
Fluorescent sensorsReal-time analysisPotential interferenceSpatial-temporal dynamics
ElectrophysiologyDirect transport measurementTechnical complexityDetailed mechanism studies

What data analysis approaches are recommended for interpreting COPT4 localization and expression patterns?

Advanced data analysis approaches enhance the interpretation of localization and expression data:

  • Co-localization analysis: Use Pearson's correlation coefficient or Manders' overlap coefficient for quantitative co-localization analysis

  • 3D reconstruction: Generate volume renderings from z-stack confocal images

  • Fluorescence intensity quantification: Measure relative expression levels across tissues/conditions

  • Time-lapse analysis: Track dynamic changes in localization or expression

Sensitivity analysis using data tables (similar to the approach described for Excel data analysis ) can help identify key variables affecting COPT4 expression or localization patterns. Consider:

  • Creating multi-variable data tables to analyze interactions between factors

  • Setting up one-variable data tables to test sensitivity to individual parameters

  • Using heat maps to visualize expression patterns across tissues and conditions

How might CRISPR-based approaches advance COPT4 functional studies?

CRISPR/Cas9 technology offers powerful approaches for COPT4 functional studies:

  • Domain-specific mutagenesis: Target specific functional domains rather than creating null alleles

  • Base editing: Introduce specific amino acid changes without double-strand breaks

  • CRISPRi/CRISPRa: Modulate COPT4 expression without altering the sequence

  • Prime editing: Make precise edits to study structure-function relationships

These approaches can be implemented using similar techniques to those used for creating expansin mutants in Arabidopsis , but with more precise targeting strategies.

What is the potential role of COPT4 in plant-pathogen interactions and immunity?

Exploring COPT4's role in plant-pathogen interactions represents an emerging research direction:

  • Pathogen challenge experiments: Compare wild-type and copt4 mutant responses to pathogens

  • Expression analysis: Monitor COPT4 expression during pathogen infection

  • Copper distribution analysis: Track copper localization during immune responses

  • Co-expression analysis: Identify correlations between COPT4 and immunity genes

This research direction builds on observations that copper plays important roles in plant immunity and that disease resistance genes in Arabidopsis show complex expression and recombination patterns . The potential connection between copper homeostasis and resistance gene function represents an underexplored area that could reveal new insights into plant immune system function.

How can systems biology approaches integrate COPT4 function into whole-plant copper homeostasis models?

Systems biology offers powerful tools for understanding COPT4 within the broader context of plant copper homeostasis:

  • Network modeling: Develop mathematical models of copper transport and utilization

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data

  • Flux analysis: Trace copper movement through the plant system

  • Machine learning approaches: Identify non-obvious patterns in complex datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.