Recombinant Arabidopsis thaliana Copper transporter 6 (COPT6)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Key Features

COPT6 belongs to the conserved CTR/COPT family of high-affinity copper transporters. Its structural features include:

  • Full-length sequence: 145 amino acids (1–145aa) with a molecular weight of ~17 kDa .

  • Transmembrane domains: Contains two transmembrane helices (TM1 and TM2), critical for forming a pore-like structure in the plasma membrane .

  • Methionine-rich motifs: Conserved Met residues (e.g., Met106 in TM2) are essential for copper transport efficiency, while Met27 in the N-terminal domain is dispensable under copper-replete conditions .

  • His-tag modification: Recombinant COPT6 is typically fused with an N-terminal His tag (e.g., 6xHis) for affinity purification via nickel- or cobalt-based chromatography .

ParameterValueSource
UniProt IDQ8GWP3
Expression SystemE. coli or S. cerevisiae
Purity>85%–90% (SDS-PAGE)
Storage BufferTris/PBS with 6% trehalose, pH 8.0

Functional Role of Native COPT6

While the recombinant protein serves as a research tool, its native counterpart plays critical roles in copper homeostasis:

  • Copper uptake and distribution: Localized to the plasma membrane, COPT6 mediates copper influx and redistribution, particularly under copper-deficient conditions .

  • Tissue-specific expression: Predominantly expressed in vascular tissues, reproductive organs (e.g., sepals, petals, pollen), and embryos .

  • Regulation by SPL7: Expression is modulated by the transcription factor SPL7, which responds to copper availability .

  • Interaction with homologs: Forms hetero-oligomers with COPT1 (root-specific transporter) and COPT5 (tonoplast-localized mobilizer) .

Key Mutant Phenotypes

ConditionPhenotypeSource
Copper deficiencyIncreased Cu in leaves, reduced Cu in seeds
OverexpressionImproved Cu tolerance in excess conditions

Recombinant COPT6 Production and Applications

Recombinant COPT6 is produced via heterologous expression systems for functional studies:

  • Expression hosts:

    • E. coli: Used for large-scale production, yielding soluble protein suitable for biochemical assays .

    • S. cerevisiae: Used to study copper transport activity in vivo, as COPT6 rescues yeast ctr1Δ ctr3Δ mutants .

  • Purification: Affinity chromatography (His-tag), followed by size-exclusion chromatography for higher purity .

Common Applications

ApplicationDetailsSource
Yeast complementationDemonstrates COPT6’s copper uptake capacity
Fluorescence localizationConfirms plasma membrane targeting in Arabidopsis protoplasts
Protein-protein interactionBimolecular fluorescence complementation (BiFC) assays with COPT1/COPT5

Research Findings and Significance

  • Copper homeostasis: COPT6 facilitates shoot copper redistribution during deficiency, as shown by altered Cu distribution in copt6 mutants .

  • Structural insights: The N-terminal domain enhances transport efficiency under low copper but is dispensable under copper-replete conditions .

  • Cross-talk with iron: Overexpression of COPT6 or COPT2 disrupts iron homeostasis, suggesting regulatory interactions between copper and iron pathways .

Challenges and Future Directions

  • Stability issues: Repeated freeze-thaw cycles reduce activity; storage at -20°C/-80°C is recommended .

  • Functional redundancy: COPT6’s role overlaps with COPT1 and COPT2, requiring precise genetic or biochemical dissection .

  • Biotechnological potential: Engineering COPT6 for enhanced copper uptake could improve crop resilience to copper-deficient soils .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
COPT6; At2g26975; T20P8; Copper transporter 6; AtCOPT6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
COPT6
Target Protein Sequence
MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLL AVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGF AVGFMLFGSTAFKNPSDDEKPFEQL
Uniprot No.

Target Background

Function
COPT6 is involved in copper transport.
Gene References Into Functions
  1. A T-DNA knockout allele study strongly implicates Copper Transporter 6 (COPT6; AT2G26975) in copper transport. (PMID: 26599497)
  2. COPT6 expression is regulated by copper availability, partly through the copper homeostasis master regulator SPL7. (PMID: 22865877)
  3. Restoring wild-type COPT6 in a *copt6* mutant fully rescued altered copper distribution, highlighting COPT6's role in shoot copper redistribution under limited copper conditions. (PMID: 23766354)
  4. Cadmium (Cd) induces SPL7-dependent copper deficiency responses, affecting the expression of COPT1, COPT2, COPT6, CSD1, CSD2, miRNA398 b/c precursors, and FSD1. (PMID: 23835944)
Database Links

KEGG: ath:AT2G26975

STRING: 3702.AT2G26975.1

UniGene: At.44738

Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.