Recombinant Arabidopsis thaliana Cyclic nucleotide-gated ion channel 11 (CNGC11)

Shipped with Ice Packs
In Stock

Description

Physiological Roles of Native CNGC11

CNGC11 is part of a 20-member Arabidopsis CNGC family involved in calcium (Ca²⁺) signaling, stress responses, and developmental processes. Key functions include:

FunctionMechanism/RoleSource
Ca²⁺ SignalingMediates Ca²⁺ influx during gravitropism and senescence; synergizes with CNGC12 .
Pathogen DefenseContributes to hypersensitive response (HR) and PR gene activation .
Senescence RegulationExpressed during dark-induced senescence; loss correlates with accelerated chlorophyll degradation .

Channel Activity and Subunit Interaction

  • Mutant Analysis: Mutations G459R and R381H in the chimeric AtCNGC11/12 disrupt subunit interaction, abolishing Ca²⁺-permeability and pathogen-induced cell death .

  • Yeast Complementation: Native CNGC11 functions as a K⁺/Ca²⁺ channel in yeast, but Arabidopsis mutants show Ca²⁺ sensitivity without altered homeostasis .

Electrophysiological Regulation

CNGC11 activity is modulated by cyclic nucleotides (cAMP/cGMP) and calmodulin (CaM), enabling Ca²⁺-dependent signaling in guard cells and root hairs .

Experimental Models

Model SystemApplicationOutcome
Nicotiana benthamianaTransient expression to study HR-mediated cell deathSuppressed by G459R and R381H mutants
YeastFunctional complementation to assess ion selectivityConfirms K⁺/Ca²⁺ permeability
Arabidopsis KnockoutsAnalysis of gravitropic bending and senescence in cpr22 mutantsSynergistic roles with CNGC12

Key Techniques

  • Bimolecular Fluorescence Complementation (BiFC): Confirmed subunit oligomerization defects in mutants .

  • Fast-PROtein Liquid Chromatography (FPLC): Analyzed peptide interactions to map mutation-induced structural changes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify your needs when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CNGC11; At2g46440; F11C10.13; Cyclic nucleotide-gated ion channel 11; Cyclic nucleotide- and calmodulin-regulated ion channel 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-621
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CNGC11
Target Protein Sequence
MNLQRRKFVRLDSTGVDGKLKSVRGRLKKVYGKMKTLENWRKTVLLACVVALAIDPLFLF IPLIDSQRFCFTFDKTLVAVVCVIRTFIDTFYVIHIIYYLITETIAPRSQASLRGEIVVH SKATLKTRLLFHFIVDIISVLPIPQVVVLTLIPLSASLVSERILKWIILSQYVPRIIRMY PLYKEVTRAFGTVAESKRVGAALNFFLYMLHSYVCGAFWYLSSIERKSTCWRAACARTSD CNLTVTDLLCKRAGSDNIRFLNTSCPLIDPAQITNSTDFDFGMYIDALKSGVLEVKPKDF PRKFVYCFWWGLRNISALGQNLETSNSAGEIFFAIIICVSGLLLFAVLIGNVQKYLQSST TRVDEMEEKKRDTEKWMSYREIPEYLKERIRRFEDYKWRRTKGTEEEALLRSLPKDLRLE TKRYLFLKLLKKVPLLQAMDDQLLDALCARLKTVHYTEKSYIVREGEPVEDMLFIMRGNL ISTTTYGGRTGFFNSVDLIAGDSCGDLLTWALYSLSSQFPISSRTVQALTEVEGFVISAD DLKFVATQYRRLHSKQLQHMFRFYSLQWQTWAACFIQAAWKRHCRRKLSKALREEEGKLH NTLQNDDSGGNKLNLGAAIYA
Uniprot No.

Target Background

Function
Putative cyclic nucleotide-gated ion channel.
Gene References Into Functions
  1. Residues crucial for intersubunit interactions of CNGC12 and CNGC11 PMID: 23735507
  2. AtCNGC11 and 12 mediate a Ca2+ signal that plays a role in plant immunity and developmental processes such as gravitropic bending and senescence. PMID: 22041991
  3. AtCNGC11 and 12 gene expression was induced during dark-induced senescence. AtCNGC11 and 12 knockout mutants exhibited enhanced chlorophyll loss, which was even more pronounced in the double mutant, suggesting synergistic roles in senescence. PMID: 21414958
  4. The AlphaC-helix in the cyclic nucleotide binding domain is functionally significant for CNGC11 and CNGC12. PMID: 20378667
  5. A 3-kb deletion fuses two cyclic nucleotide-gated ion channel (ATCNGC)-encoding genes, ATCNGC11 and ATCNGC12, to generate a novel chimeric gene, ATCNGC11/12. PMID: 16461580
Database Links

KEGG: ath:AT2G46440

STRING: 3702.AT2G46440.1

UniGene: At.19641

Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of AtCNGC11?

AtCNGC11 is one of 20 members of the cyclic nucleotide-gated ion channel family in Arabidopsis thaliana. It contains transmembrane domains that form the channel pore, a C-linker region, and a cyclic nucleotide-binding domain (CNBD). The C-terminal cytosolic region is critical for channel assembly and regulation. Computational modeling of AtCNGC11/12 was conducted using the crystallized structure of the cytoplasmic C terminus of the invertebrate CNGC, SpIH, with protein fold recognition servers estimating 100% precision . The channel is believed to function as a tetramer, with important regulatory domains including CaM-binding sites.

What is known about the genomic organization of AtCNGC11?

AtCNGC11 (AT2G46440) is located adjacent to AtCNGC12 (AT2G46450) in the Arabidopsis genome . This tandem arrangement has significant implications, as demonstrated by the cpr22 mutation, which creates a 3-kb deletion fusing these two genes into a novel chimeric gene (AtCNGC11/12) . This genomic organization may indicate evolutionary relationships and functional overlap between these channels.

How does AtCNGC11 contribute to plant defense responses?

AtCNGC11 functions as a positive mediator of resistance against certain pathogens. Analysis of knockout lines revealed that both AtCNGC11 and AtCNGC12 are positive mediators of resistance against an avirulent biotype of Hyaloperonospora parasitica . Additionally, resistance mediated by the chimeric AtCNGC11/12 requires NDR1-dependent and EDS1/PAD4-dependent pathways . The involvement in these established defense signaling pathways positions AtCNGC11 as an important component of plant immunity.

How do the defense responses mediated by AtCNGC11 compare with other CNGCs?

Several AtCNGCs, including AtCNGC2, AtCNGC4, AtCNGC11, and AtCNGC12, have been implicated in pathogen defense . The AtCNGC2 mutant (dnd1) displays reduced hypersensitive response (HR) development but enhanced basal resistance to certain pathogens with accumulation of salicylic acid . Similarly, AtCNGC11 and AtCNGC12 contribute to defense but through potentially different mechanisms. AtCNGC11/12 can induce HR-like cell death when transiently expressed in Nicotiana benthamiana , suggesting a role in programmed cell death during pathogen recognition.

What are effective heterologous expression systems for functional analysis of AtCNGC11?

Three major heterologous systems have been effectively used to study AtCNGC11:

Expression SystemApplicationsAdvantagesNotable Results
Xenopus oocytesElectrophysiology, ion selectivityTwo-electrode voltage clamp (TEVC) enables direct measurement of channel activityAtCNGC11 alone was inactive; CNGC11+CNGC12 co-expression produced currents similar to CNGC12 alone
Yeast (S. cerevisiae)Functional complementation of K⁺ uptake-deficient mutantsTests channel function in a eukaryotic systemAtCNGC11 can function as K⁺ and Ca²⁺ channels
Nicotiana benthamianaTransient expression, cell death assaysPlant-based system for in planta analysesAtCNGC11/12 induces cell death in a synchronized manner

How can protein-protein interactions of AtCNGC11 be effectively studied?

Several techniques have proven effective for studying AtCNGC11 interactions:

  • Yeast two-hybrid (Y2H) analysis: Used to detect protein interactions, particularly with calcium-signaling components such as calmodulins .

  • Bimolecular fluorescence complementation (BiFC): Employed to visualize protein interactions in planta. For example, BiFC revealed that while CNGC12 interacts with CaM1, CNGC12 showed no interaction with CNGC11 .

  • Fast-protein liquid chromatography (FPLC): Used with recombinantly expressed C-terminal peptides to study subunit stoichiometry and multimeric channel formation .

  • In vitro pull-down assays: Used to study interactions between purified proteins, such as between CNGC12 and CaM1 .

What genetic approaches are useful for investigating AtCNGC11 function in planta?

Several genetic approaches have proven valuable:

  • T-DNA insertion knockout lines: Homozygous T-DNA insertion lines like cngc11-1 (salk_026568) have been used to study loss-of-function phenotypes .

  • Double mutant analysis: cngc11/cngc12 double mutants revealed synergistic roles of these channels in processes like gravitropism and senescence .

  • Suppressor screens: Screens identifying suppressors of the cpr22 phenotype have yielded valuable insights into structure-function relationships, identifying key residues important for channel function .

  • Transgenic complementation: Expression of wild-type or mutated versions of AtCNGC11 in knockout backgrounds to confirm gene function and analyze specific domains or residues .

What is the AtCNGC11/12 chimeric channel and what are its unique properties?

The AtCNGC11/12 chimeric channel was identified in the Arabidopsis mutant constitutive expresser of PR genes22 (cpr22), which results from a 3-kb deletion that fuses the AtCNGC11 and AtCNGC12 genes . This chimeric channel exhibits several unique properties:

  • It constitutively activates multiple defense responses, including PR gene expression and pathogen resistance .

  • It induces spontaneous cell death when expressed transiently in Nicotiana benthamiana .

  • The phenotype conferred by cpr22 appears to be regulated by the ratio between AtCNGC11/12 and AtCNGC12, as overexpression of AtCNGC12 (but not AtCNGC11) suppressed the cpr22 phenotype .

What techniques have revealed important structure-function relationships in AtCNGC11?

Several structure-function relationships have been discovered through:

  • Suppressor screens of the cpr22 mutant: A total of 29 mutant alleles in AtCNGC11/12 have been discovered, revealing functionally important residues .

  • Site-directed mutagenesis: Identified key residues such as Glu519, which is essential for channel function .

  • Computational modeling: Used to predict tertiary structure and identify potentially important functional domains .

  • Functional complementation in yeast: Demonstrated that specific mutations (e.g., G459R and R381H) alter channel function .

Can AtCNGC11 form heteromeric channels with other CNGCs?

The evidence for heteromeric channels is mixed:

The conflicting evidence suggests that CNGC subunit interactions may be specific and regulated, and not all closely related CNGCs necessarily form heteromeric channels.

How is AtCNGC11 regulated by cyclic nucleotides compared to other CNGCs?

Unlike animal CNGCs, which are gated by cyclic nucleotide monophosphates (cNMPs), plant CNGCs show variable responses to these second messengers:

  • Electrophysiological studies revealed that neither CNGC11 nor CNGC12 activities were affected by cAMP or cGMP .

  • The application of 0.1 mM dibutyryl-cAMP or 8Br-cGMP did not alter current amplitudes in CNGC11- or CNGC12-expressing oocytes .

  • This differs from some other Arabidopsis CNGCs that function as cyclic nucleotide-gated Ca²⁺-permeable channels .

These findings suggest that plant CNGCs may have evolved different regulatory mechanisms compared to their animal counterparts.

What role does calmodulin play in regulating AtCNGC11?

The relationship between calmodulin (CaM) and AtCNGC11 appears complex:

  • While CNGC12 was shown to interact with CaM1 and CaM6 in yeast two-hybrid assays, similar strong evidence for CNGC11-CaM interaction is lacking .

  • BiFC assays demonstrated that CNGC12 can interact with CaM1 in the plasma membrane of plant cells, but CNGC12 showed no interaction with CNGC11 .

  • For comparison, CNGC12 contains multiple CaM-binding domains at both N- and C-terminal cytosolic regions and is regulated both positively and negatively by CaMs .

This suggests potential differences in CaM-mediated regulation between CNGC11 and CNGC12.

What mutations affect AtCNGC11 function and what do they reveal about channel regulation?

Several key mutations have provided insights into AtCNGC11 regulation:

  • A glutamate to lysine substitution (E519K) at the beginning of the eighth β-sheet of the cyclic nucleotide-binding domain in AtCNGC11/12 abolished channel function and suppressed cpr22-related phenotypes .

  • Two other mutations, G459R and R381H in AtCNGC11/12, also suppressed channel function .

  • These mutations influenced subunit stoichiometry for multimeric channel formation as demonstrated by FPLC analysis .

  • In a different CNGC (CNGC20), a L371F exchange on a predicted transmembrane channel inward surface led to increased cytosolic Ca²⁺ accumulation, consistent with mis-regulation of CNGC channel activity .

These findings highlight specific residues critical for proper channel assembly and function.

How do AtCNGC11 and AtCNGC12 contribute to gravitropism?

AtCNGC11 and AtCNGC12 play synergistic roles in gravitropic responses:

  • Both channels contribute to the generation of Ca²⁺ signals that lead to gravitropic bending .

  • Knockout mutants of AtCNGC11 and AtCNGC12 showed altered gravitropic responses, with the effects being more pronounced in the double mutant .

  • This suggests these channels are specifically involved in the Ca²⁺ signaling required for proper gravitropic responses rather than general Ca²⁺ homeostasis.

What is the role of AtCNGC11 in plant senescence?

AtCNGC11 and AtCNGC12 are implicated in the regulation of senescence processes:

  • Expression of both AtCNGC11 and AtCNGC12 is induced during dark-induced senescence .

  • Knockout mutants displayed enhanced chlorophyll loss during dark-induced senescence .

  • The effect was more pronounced in the double mutant, indicating synergistic roles in this process .

  • This suggests a protective role of these channels in regulating senescence progression, potentially through calcium signaling pathways.

How can experimental conditions be optimized to study AtCNGC11's multiple physiological roles?

When designing experiments to study AtCNGC11's diverse functions, consider:

  • For gravitropism studies: Use gravitropic bending assays with both single and double knockout mutants, and measure calcium flux using appropriate reporters (e.g., aequorin-based systems) .

  • For senescence studies: Employ dark-induced senescence protocols with measurements of chlorophyll content, senescence-associated gene expression, and calcium signaling .

  • For overlapping functions with other CNGCs: Design experiments using higher-order mutants (e.g., triple or quadruple knockouts) of closely related CNGCs to overcome functional redundancy.

  • For tissue-specific roles: Utilize tissue-specific promoters to drive expression of wild-type or mutant forms of AtCNGC11 in knockout backgrounds.

  • For conditional phenotypes: Apply various abiotic stresses (e.g., calcium stress, salt stress) to reveal conditional phenotypes that may not be apparent under standard growth conditions .

These approaches can help disentangle the multiple physiological roles of AtCNGC11 and distinguish them from the functions of related CNGCs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.