Recombinant Arabidopsis thaliana CYSTM1 family protein A (At2g41420)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana CYSTM1 Family Protein A (At2g41420)

Recombinant Arabidopsis thaliana CYSTM1 family protein A (At2g41420), also known as WIH2, is a proline-rich uncharacterized protein expressed in Arabidopsis thaliana. It belongs to the cysteine-rich and transmembrane domain-containing protein family (CYSTM1) and is primarily used in research for studying plant molecular mechanisms, protein interactions, and functional genomics. The recombinant version is produced in heterologous systems like E. coli, yeast, or mammalian cells, enabling structural and biochemical analyses .

Gene and Protein Information

Gene Details

AttributeValue
Gene IDAt2g41420
SynonymsWIH2, T26J13.1, F13H10.3
Protein Length98 amino acids (1–98) [1–98aa]
UniProt AccessionQ8S8M0
Pfam DomainProline-rich family protein

Protein Characteristics

  • Primary Structure: Contains proline-rich motifs and cysteine-rich domains, suggesting roles in protein-protein interactions or cell wall integrity .

  • Expression: Truncated versions (e.g., AtAC261-388) are often used for functional studies, though full-length recombinants are also available .

  • Tagging: Typically His-tagged for affinity purification .

Functional and Research Context

While At2g41420 is annotated as a proline-rich protein, its specific biological function remains uncharacterized. Limited studies suggest potential roles in:

  • Cell Wall Dynamics: Proline-rich proteins often stabilize cell walls or mediate stress responses .

  • Protein Interactions: Cysteine-rich domains may facilitate interactions with other proteins or membranes .

Related Proteins

ProteinGene IDFunction
CYSTM1 Family Protein BAt3g57160Cysteine-rich TM module stress protein
WIH1At2g41420 (homolog)Proline-rich family protein

Research Applications and Challenges

Applications

  • ELISA/Western Blot: Used as a control or antigen in immunoassays .

  • Structural Studies: Full-length recombinants enable X-ray crystallography or NMR .

Limitations

  • Functional Data Gaps: No peer-reviewed studies directly link At2g41420 to specific pathways or phenotypes.

  • Expression Challenges: Full-length versions may require specialized refolding protocols post-purification .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
WIH2; At2g41420; T26J13.1; Cysteine-rich and transmembrane domain-containing protein WIH2; Cysteine-rich and transmembrane domain-containing protein A; Protein WINDHOSE 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
WIH2
Target Protein Sequence
MSQYNQPPVGVPPPQGYPPEGYPKDAYPPQGYPPQGYPQQGYPPQGYPQQGYPQQGYPPP YAPQYPPPPQHQQQQSSPGFLEGCLAALCCCCLLDACF
Uniprot No.

Target Background

Function
This protein is essential for the promotion of megasporogenesis, which is the process of germ cell formation from somatic precursor cells. It functions redundantly with WIH1. CYSTM1 family protein A acts within a genetic pathway downstream of SPL/NZZ and WUS. Together with TRN2, it plays a crucial role in promoting megasporogenesis.
Database Links

KEGG: ath:AT2G41420

STRING: 3702.AT2G41420.1

UniGene: At.43111

Protein Families
CYSTM1 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in floral organ primordia.

Q&A

Where is CYSTM1 family protein A localized in plant cells?

Most PCM proteins, including CYSTM1 family protein A, primarily localize to the plasma membrane. This localization has been confirmed through transient expression assays in Nicotiana benthamiana using fluorescent protein tags . The membrane association is mediated by the CYSTM domain, which is predicted to form a transmembrane segment. The conserved cysteines in this domain may facilitate interactions with other membrane components or proteins, potentially through the formation of disulfide bridges or other forms of protein-protein interactions .

What is the expression pattern of CYSTM1 family protein A in Arabidopsis?

CYSTM1 family protein A is responsive to various pathogen challenges and defense-related signals, particularly salicylic acid (SA). RNA-seq analysis has shown that the gene is significantly upregulated in response to SA treatment . The expression behavior broadly follows patterns seen within its subgroup of PCM genes, showing both overlaps and differences with members of other subgroups. This differential expression is consistent with varying overrepresentation of different transcription factor binding DNA motifs in the promoters of the PCM genes .

How do CYSTM domain-containing proteins function in plants?

CYSTM domain-containing proteins are present in diverse species across eukaryotic organisms, suggesting conserved functional importance. While the exact molecular mechanism remains unclear, these proteins appear to play roles in stress tolerance. Proposed mechanisms include:

  • Altering the redox potential of membranes

  • Quenching radical species to protect the plant

  • Affecting membrane-associated protein functions

  • Facilitating protein-protein interactions through their conserved cysteines

The cysteines may serve as interaction sites for ligands or other PCM proteins, potentially resulting in homo- or heterodimerization. Some family members, such as PCM4/PCC1, interact with components of signaling complexes at the plasma membrane, which may lead to post-translational control of multiple protein targets involved in diverse biological processes including light signaling, development, and immunity .

How can recombinant CYSTM1 family protein A be obtained for research?

Recombinant CYSTM1 family protein A can be produced through in vitro E. coli expression systems. Commercial versions typically include an N-terminal 10xHis-tag for purification purposes . For proper storage, it is recommended to keep the protein at -20°C, or at -80°C for extended storage. Working aliquots should be stored at 4°C for up to one week, and repeated freezing and thawing should be avoided .

Alternatively, plant-based expression systems can be used, particularly for proteins that require plant-specific post-translational modifications. The protein can be expressed in Arabidopsis seeds using the appropriate promoter (such as the 12S1 promoter) and the 3'UTR of seed storage protein genes to enhance accumulation .

How does overexpression of CYSTM1 family proteins affect plant immunity and development?

Overexpression studies have revealed that PCM proteins, including CYSTM1 family members, have significant impacts on plant performance. Key findings include:

  • Enhanced protection against biotrophic pathogens: All eight PCM family members, when overexpressed in Arabidopsis, conferred enhanced resistance against the biotrophic oomycete pathogen Hyaloperonospora arabidopsidis Noco2 .

  • Subgroup-specific effects: Overexpression of PCM subgroup I genes specifically conferred enhanced resistance to the hemi-biotrophic bacterial pathogen Pseudomonas syringae pv. tomato DC3000 .

  • Developmental impacts: PCM-overexpressing lines showed altered expression of genes related to light signaling and development. Notably, PCM-overexpressing seedlings displayed elongated hypocotyl growth, suggesting a connection between disease resistance and photomorphogenesis .

  • Absence of typical defense gene induction: Interestingly, overexpression of PCMs led to the induction of genes associated with light responses and development, but not to typical defense-associated responses, suggesting a novel mechanism of action .

These findings suggest that CYSTM1 and related proteins may function at the interface of immunity and development, possibly through effects on membrane structure or the activity of interacting proteins at the plasma membrane.

What role does S-acylation play in CYSTM1 family protein function?

S-acylation (also known as palmitoylation) is a post-translational modification that can affect protein localization, stability, and activity. While specific S-acylation data for CYSTM1 is limited, research on related membrane proteins in Arabidopsis suggests that S-acylation can significantly impact receptor activity.

For instance, the P2K1 receptor, which mediates extracellular ATP-induced immune signaling, undergoes S-acylation that affects its temporal dynamics through autophosphorylation and protein degradation . The potential S-acylation sites can be predicted using software such as GPS-lipid 1.0 (http://lipid.biocuckoo.org/webserver.php).

To experimentally determine S-acylation status, researchers typically:

  • Generate mutant forms where cysteine (C) sites are individually mutated to serine (S)

  • Express these mutants in Arabidopsis protoplasts

  • Determine S-acylation status through parallel assays with or without the hydroxylamine thioester-cleavage step

Given the importance of cysteine residues in CYSTM1, S-acylation could be a critical regulatory mechanism affecting its function in immunity and development.

What methodologies are most effective for studying CYSTM1 protein interactions and membrane association?

Several approaches have proven effective for studying CYSTM1 and related proteins:

  • Transient expression assays: Fluorescent protein fusions (e.g., YFP) can be used to visualize subcellular localization in Nicotiana benthamiana leaves.

  • Yeast expression systems: Yeast two-hybrid or split-ubiquitin systems have been used to demonstrate homo- or heterodimerization of PCM family members.

  • Co-immunoprecipitation: For identifying protein interaction partners at the plasma membrane.

  • Recombinant protein binding assays: His-tagged and GST-tagged proteins can be used in pull-down assays with Ni-NTA and GS4B beads to study direct protein interactions .

  • S-acylation assays: Parallel assays with or without hydroxylamine thioester-cleavage steps can determine S-acylation status.

  • Membrane fractionation: Differential centrifugation can be used to isolate membrane fractions and confirm protein localization.

MethodApplicationAdvantagesLimitations
Transient expressionLocalization studiesRapid results, in plantaMay not reflect native conditions
Co-IPProtein interactionsCaptures in vivo complexesMay detect indirect interactions
Yeast systemsDimerization studiesControlled conditionsNon-plant environment
Pull-down assaysDirect bindingConfirms direct interactionsUses purified proteins
S-acylation assaysPost-translational modificationsIdentifies specific sitesLabor intensive

How can the 3'UTR of seed storage protein genes enhance recombinant CYSTM1 protein production?

A promising approach for enhancing recombinant protein production in plants involves using the 3'UTR of seed storage protein (SSP) genes. Research has shown that:

  • The 3'UTR of SSP genes are essential for SSP accumulation and can significantly increase recombinant protein yields in Arabidopsis.

  • Fusion of the 3'UTR of SSP genes (such as 12S1) to the 3' ends of DNA sequences encoding recombinant proteins enables massive accumulation of recombinant proteins with retained enzymatic activity in Arabidopsis seeds .

  • This method does not require altering the intracellular localization of recombinant proteins, allowing proteins to maintain their correct localization and functionality under near-native cellular conditions.

  • The approach has been successfully applied to various proteins, including enzymes like peroxisomal malate dehydrogenase 1 (pMDH1) and biopharmaceutical candidates like human Interferon Lambda-3 .

For CYSTM1 family protein A, this approach could be particularly valuable since it would allow production of the protein in its native plant environment, potentially preserving important post-translational modifications and structural features.

How do CYSTM1 family proteins compare across different plant species and what can evolutionary analysis reveal?

The CYSTM domain is highly conserved across eukaryotic organisms, suggesting fundamental importance in cellular function. CYSTM domain-containing proteins are present in diverse species including Arabidopsis, Caenorhabditis elegans, Candida albicans, Homo sapiens, Mus musculus, Oryza sativa, Saccharomysces cerevisae, and Zea mays .

Evolutionary analysis of these proteins can reveal:

  • Conserved functional domains and critical amino acid residues

  • Species-specific adaptations in response to different pathogens

  • Expansion or contraction of the gene family in different lineages

  • Potential neofunctionalization or subfunctionalization after gene duplication events

For researchers studying CYSTM1, phylogenetic trees can be generated using tools like PLAZA v4.0 (https://bioinformatics.psb.ugent.be/plaza/) with the PCM1 gene as a query . Such analyses help contextualize the role of CYSTM1 in Arabidopsis within the broader evolutionary history of this protein family across plants and other organisms.

Protocols for expression and purification of recombinant CYSTM1 family protein A

Bacterial Expression System:

  • Clone the full-length CYSTM1 coding sequence into an appropriate expression vector (e.g., with an N-terminal His-tag).

  • Transform into an E. coli expression strain.

  • Induce protein expression with IPTG.

  • Lyse cells and purify using Ni-NTA affinity chromatography.

  • Verify protein purity by SDS-PAGE and Western blotting.

  • Store purified protein at -20°C or -80°C for extended storage .

Plant-Based Expression System:

  • Construct expression vectors containing:

    • The 12S1 promoter (approximately 1671 bp upstream of the 12S1 gene)

    • The CYSTM1 coding sequence

    • The 3'UTR of 12S1 gene for enhanced protein accumulation

    • Optional: His-tag or other purification tags

  • Clone these components using Gateway® cloning technology:

    • Clone promoter sequence into pDONRP4P1R

    • Clone coding sequence into pDONR221

    • Combine into R4pGWB501 using Multisite Gateway® technology

  • Transform the expression vector into Agrobacterium tumefaciens strain C58C1 rif.

  • Transform Arabidopsis plants using the floral dip method.

  • Select transformants on medium containing 25 μg/mL hygromycin B.

  • Evaluate protein accumulation in at least ten independent T3 progeny .

Techniques for analyzing CYSTM1 function in plant immunity

To study the role of CYSTM1 in plant immunity, researchers can employ several approaches:

Pathogen Challenge Assays:

  • Generate CYSTM1 overexpression and knockout/knockdown lines.

  • Challenge plants with pathogens such as:

    • Hyaloperonospora arabidopsidis Noco2 (biotrophic oomycete)

    • Pseudomonas syringae pv. tomato DC3000 (hemi-biotrophic bacteria)

  • Assess disease resistance by measuring:

    • Pathogen growth/sporulation

    • Disease symptoms

    • Expression of defense marker genes

Growth Conditions for Arabidopsis:

  • Stratify seeds at 4°C in the dark for three days

  • Germinate on ½ MS sterilized plates in growth chambers

  • Maintain under long day conditions (21°C; 16 hr light/8 hr dark)

  • For leaf tissue experiments, use plants grown on soil for 5 weeks after germination

Genetic Analysis:

  • To prevent carry-over mutations from generations of homozygous mutants, use leaves from homozygous mutant plants segregated from heterozygous plants

Molecular Characterization:

  • RNA-seq analysis can identify genes differentially expressed between wild-type and CYSTM1-overexpressing or CYSTM1-knockout plants

  • Use tools like DESeq2 for identifying differentially expressed genes

  • Gene ontology (GO) analysis can reveal biological processes affected by CYSTM1 manipulation

Methods for studying subcellular localization and protein-protein interactions

Subcellular Localization:

  • Generate fusion proteins with fluorescent tags (e.g., YFP-CYSTM1).

  • Express in plant systems through:

    • Transient expression in Nicotiana benthamiana leaves

    • Stable transformation in Arabidopsis

  • Visualize using confocal microscopy.

  • Use appropriate markers for co-localization studies (e.g., plasma membrane markers).

Protein-Protein Interaction Studies:

  • Yeast Two-Hybrid (Y2H):

    • Clone CYSTM1 into bait and prey vectors

    • Screen for interactions with known immunity-related proteins

    • Verify potential interactions through directed Y2H assays

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged versions of CYSTM1 in plants

    • Immunoprecipitate using tag-specific antibodies

    • Identify interacting proteins by mass spectrometry

  • Pull-Down Assays:

    • Use His-tagged CYSTM1 with Ni-NTA beads

    • Analyze precipitated proteins by SDS-PAGE and mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse CYSTM1 and potential interactors to split YFP fragments

    • Co-express in plant cells

    • Visualize reconstituted fluorescence as evidence of interaction

ChIP-seq and transcriptomic analysis protocols for studying CYSTM1 regulation

While CYSTM1 itself is not a transcription factor, understanding its regulation and downstream effects can benefit from ChIP-seq and transcriptomic analyses:

RNA-seq Analysis Protocol:

  • Extract RNA from appropriate tissues (e.g., leaves treated with SA or pathogen challenge).

  • Prepare RNA-seq libraries following standard protocols.

  • Sequence using appropriate platforms (e.g., Illumina).

  • Map reads to the Arabidopsis genome (TAIR version 10) using TopHat.

  • Summarize aligned reads over annotated gene models using HTseq-count.

  • Identify differentially expressed genes using a generalized linear model or DESeq2 .

ChIP-seq Protocol for Studying Transcription Factors Regulating CYSTM1:

  • Grow Arabidopsis plants under appropriate conditions:

    • Stratify seeds at 4°C in the dark for three days

    • Germinate on ½ MS plates or soil

    • Grow under long day conditions (21°C; 16 hr light/8 hr dark)

    • Harvest tissue at appropriate time points

  • Perform chromatin immunoprecipitation using antibodies against transcription factors of interest.

  • Prepare ChIP-seq libraries and sequence.

  • Analyze data to identify binding sites in the CYSTM1 promoter region.

  • Validate binding using techniques such as electrophoretic mobility shift assay (EMSA) or luciferase reporter assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.