Recombinant Arabidopsis thaliana CYSTM1 family protein B (At3g57160)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Pathways

While direct functional studies on At3g57160 in Arabidopsis remain limited, insights from homologs in other organisms and sequence analysis provide clues:

Proposed Mechanisms

  • Membrane Anchoring: Yeast CYSTM homologs (e.g., Cpp1, Cpp2) are palmitoylated and anchored to the plasma membrane (PM) via lipid modifications, rather than transmembrane domains . This suggests a potential role in membrane-associated processes.

  • Stress Tolerance: The protein is annotated as a "stress tolerance protein" in some databases, though experimental validation is pending .

Pathways and Interactions

  • Palmitoylation: In yeast, CYSTM proteins interact with palmitoyltransferases (e.g., Akr1) for membrane localization . A similar mechanism may exist in Arabidopsis.

  • Redox Sensitivity: While not directly studied for At3g57160, Arabidopsis sulfenylated cysteines in other proteins (e.g., MPK4, EF-Tu) highlight redox-regulated pathways that may involve CYSTM family members .

Research Applications and Tools

The recombinant At3g57160 protein and associated antibodies enable diverse experimental approaches:

Recombinant Protein Applications

ApplicationDetails
Structural StudiesX-ray crystallography or NMR to elucidate CRD structure and palmitoylation sites
Interaction AssaysCo-IP or pull-down assays to identify binding partners
Functional ScreensOverexpression/knockdown in Arabidopsis to study stress responses

Antibody Availability

Antibody TypeHostPurificationApplications
Rabbit anti-At3g57160RabbitAntigen-affinityELISA, Western blotting

Sources: .

Comparative Analysis with Yeast Homologs

Studies in Saccharomyces cerevisiae reveal conserved features that may inform Arabidopsis research:

FeatureYeast CYSTM (e.g., Cpp1) At3g57160
LocalizationPlasma membrane, daughter cell polarizedPredicted membrane-associated (unconfirmed)
Post-Translational ModificationPalmitoylated by Akr1/Erf2/Erf4Potential palmitoylation sites (unconfirmed)
DegradationRsp5-dependent ubiquitination and proteasomal degradationUnknown

Research Gaps and Future Directions

  • Functional Studies: Direct evidence for At3g57160’s role in stress tolerance or membrane dynamics is lacking.

  • Redox Regulation: Sulfenylation or nitrosylation of cysteine residues in At3g57160 remains unexplored .

  • Evolutionary Conservation: Comparative studies across eukaryotes could clarify CYSTM/CYSPD family functions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
At3g57160; F24I3; Cysteine-rich and transmembrane domain-containing protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g57160
Target Protein Sequence
MSQQPPAVGVPPSHAYPAEGPPKDAYPPPGQPYPQQGYPPPQGYPQQGYPPQGYPPQGYP EQGYPQQGYPPQQQQQQKHSPGMLEGCIAALCCYCVLDACF
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G57160

UniGene: At.34863

Protein Families
CYSTM1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Arabidopsis thaliana CYSTM1 family protein B (At3g57160) and what is its genomic context?

At3g57160 belongs to the CYSTM (cysteine-rich transmembrane module) protein family, which consists of small molecular proteins found in tail-anchored membrane proteins across eukaryotes. This protein is classified as a novel non-secreted cysteine-rich peptide (NCRP) based on its conserved domain and small molecular weight. The gene is located on chromosome 3 of Arabidopsis thaliana and encodes a protein that is 101 amino acids in length .

In Arabidopsis thaliana, researchers have identified 13 CYSTM genes distributed across five chromosomes with varying densities. These proteins can be classified into four subgroups based on domain similarity and phylogenetic topology . The CYSTM family plays vital roles in diverse developmental processes, particularly in stress responses.

What are the main structural and biochemical properties of At3g57160?

The main structural feature of At3g57160 is the cysteine-rich transmembrane module (CYSTM) that characterizes this protein family. CYSTM proteins generally contain a conserved cysteine-rich domain and are typically small molecular weight proteins. The At3g57160 protein has the following characteristics:

PropertyValue
Length101 amino acids
Molecular WeightSmall (exact value not specified in sources)
Key DomainCYSTM (cysteine-rich transmembrane module)
DimerizationCan occur through C-terminal domain
Subcellular LocalizationPrimarily plasma membrane and cytoplasm
StructureContains immunoglobulin-like fold in FBA domain

The protein has a C-terminal domain that enables dimerization with itself or other proteins. CYSTM proteins display complex subcellular localization patterns, with many detected at the plasma membrane and cytoplasm .

How does At3g57160 expression change in response to different conditions?

While specific expression data for At3g57160 is limited in the available literature, CYSTM family members generally exhibit distinctive expression patterns:

  • They are expressed in at least one of the tested tissues in Arabidopsis

  • They dramatically respond to various abiotic stresses

  • They play vital roles in resistance to abiotic stress

To determine the precise expression profile of At3g57160, researchers should:

  • Utilize resources like the Arabidopsis eFP Browser to examine expression across tissues and conditions

  • Perform RT-PCR or qRT-PCR across different tissues and stress conditions

  • Use reporter gene constructs (such as promoter:GUS or promoter:GFP fusions) to visualize expression patterns in planta

  • Conduct time-course experiments to capture the dynamics of expression changes under stress conditions

What are the known functions of At3g57160 and other CYSTM family proteins in Arabidopsis?

CYSTM family proteins, including At3g57160, function primarily in stress response mechanisms. While specific functions of At3g57160 are not extensively detailed in the available literature, insights from other CYSTM proteins provide valuable context:

  • Stress response: CYSTM members dramatically respond to various abiotic stresses, suggesting important roles in stress signaling and adaptation

  • Protein interactions: CYSTM proteins can dimerize with themselves or other proteins through their C-terminal domain, indicating roles in protein complex formation

  • Negative regulation: Analysis of CYSTM3 overexpression lines revealed negative regulation in salt stress responses, suggesting CYSTM proteins may function as stress response modulators

To fully characterize At3g57160's function, researchers should:

  • Generate and phenotype knockout/knockdown lines and overexpression lines under various stresses

  • Analyze downstream molecular changes through transcriptomics or proteomics approaches

  • Perform comparative analyses with other CYSTM family members to identify common and unique functions

What approaches can be used to study protein-protein interactions involving At3g57160?

The search results indicate that CYSTM members can dimerize with themselves or others through the C-terminal domain, and a protein-protein interaction map between CYSTM members in Arabidopsis has been constructed . To identify and characterize protein-protein interactions for At3g57160, researchers should employ multiple complementary approaches:

TechniqueApplicationAdvantages
Yeast Two-HybridInitial interaction screeningHigh-throughput, can detect binary interactions
Co-ImmunoprecipitationValidation of interactions in vivoPreserves native conditions, can identify complexes
Bimolecular Fluorescence Complementation (BiFC)In vivo visualization of interactionsShows spatial context of interactions in living cells
Surface Plasmon Resonance (SPR)Quantitative analysisProvides kinetic and affinity parameters
Isothermal Titration Calorimetry (ITC)Thermodynamic characterizationProvides complete thermodynamic profile of interactions
Protein MicroarraysLarge-scale screeningCan test thousands of potential interactions simultaneously

These complementary approaches would provide comprehensive insights into At3g57160's interaction network, providing critical information about its function within cellular pathways.

How can researchers generate recombinant At3g57160 for functional studies?

Based on available information, several approaches can be used to generate recombinant At3g57160:

  • Arabidopsis-based expression system: Arabidopsis thaliana itself can be used as an expression host for recombinant Arabidopsis proteins. This homologous system allows proper post-translational modifications and association with native partners. An Arabidopsis-based super-expression system has been reported to yield as much as 0.4 mg of purified protein per gram fresh weight .

  • Expression construct design:

    • Include an appropriate promoter (35S for strong constitutive expression, or tissue-specific promoters)

    • Add affinity tags (His, GST, MBP) for purification while considering potential effects on structure/function

    • Consider including a cleavable signal sequence for targeting to specific compartments

  • Expression considerations:

    • For membrane-associated proteins like CYSTM members, specialized approaches may be needed

    • When expressed in heterologous systems, codon optimization may improve yields

    • Consider protein stability and solubility when designing constructs

The optimal expression system should balance protein yield, native folding, and research goals .

What strategies can be used to investigate At3g57160's role in stress responses?

To elucidate At3g57160's specific role in stress responses, researchers should implement a multi-faceted experimental approach:

  • Genetic approaches:

    • Generate knockout/knockdown lines using T-DNA insertion, CRISPR/Cas9, or RNAi

    • Create overexpression lines using constitutive or inducible promoters

    • Develop complementation lines to confirm phenotype-genotype relationships

  • Phenotypic analysis:

    • Subject genetic lines to various abiotic stresses (salt, drought, cold, heat, oxidative stress)

    • Measure physiological parameters (growth, survival, photosynthetic efficiency)

    • Assess biochemical changes (ROS levels, antioxidant capacity, osmolyte accumulation)

  • Molecular analyses:

    • Perform transcriptome analysis to identify differentially expressed genes

    • Analyze protein-protein interactions under stress conditions

    • Investigate post-translational modifications in response to stress

  • Comparative studies:

    • Compare phenotypes with other CYSTM family mutants

    • Perform epistasis analysis with known stress-responsive genes

    • Analyze evolutionary conservation of stress response function across species

What are the challenges in purifying recombinant At3g57160 and how can they be addressed?

Purifying recombinant At3g57160 presents several challenges due to its nature as a small, potentially membrane-associated protein. Researchers should consider the following strategies:

  • Extraction optimization:

    • For membrane proteins, use appropriate detergents (DDM, LMNG, or digitonin)

    • Consider native extraction from Arabidopsis for studying specific post-translational modifications

    • Test different buffer conditions (pH, salt, glycerol) to maintain protein stability

  • Purification strategy:

    • Use affinity chromatography as the initial purification step (e.g., Ni-NTA for His-tagged proteins)

    • Apply size exclusion chromatography to separate monomeric from dimeric forms

    • Consider ion exchange chromatography for further purification

  • Quality assessment:

    • Verify protein identity using mass spectrometry

    • Assess purity using SDS-PAGE and Western blotting

    • Validate protein folding using circular dichroism or fluorescence spectroscopy

    • Test functional activity using appropriate assays

  • Stability considerations:

    • Identify stabilizing additives (glycerol, specific salts, reducing agents)

    • Determine optimal storage conditions (temperature, buffer composition)

    • Consider protein engineering approaches to improve stability if necessary

How can researchers effectively analyze the subcellular localization of At3g57160?

According to the available information, CYSTM peptides display complex subcellular localization, with most detected at the plasma membrane and cytoplasm . To determine At3g57160's precise subcellular localization:

  • Fluorescent protein fusion approaches:

    • Generate N- and C-terminal fluorescent protein fusions (GFP, YFP, mCherry)

    • Express in transient systems (protoplasts, N. benthamiana) and stable transgenic Arabidopsis

    • Compare results from both approaches to rule out artifacts

  • Confocal microscopy analysis:

    • Use co-localization with established organelle markers

    • Perform time-lapse imaging to capture potential dynamic localization

    • Apply super-resolution microscopy for detailed localization studies

  • Biochemical fractionation:

    • Perform subcellular fractionation to isolate different cellular compartments

    • Use Western blotting with compartment-specific markers to confirm fraction purity

    • Detect At3g57160 in different fractions using specific antibodies

  • Electron microscopy approaches:

    • Use immunogold labeling with transmission electron microscopy for high-resolution localization

    • Apply correlative light and electron microscopy (CLEM) for comprehensive analysis

  • Conditional localization studies:

    • Analyze localization under different stress conditions

    • Investigate developmental changes in localization

    • Examine the impact of protein interactions on localization

How can systems biology approaches enhance our understanding of At3g57160's function?

Systems biology offers powerful frameworks to understand At3g57160's role within broader biological contexts:

  • Network analysis:

    • Construct protein-protein interaction networks including At3g57160

    • Identify hub proteins and key network motifs

    • Determine At3g57160's position within stress response networks

  • Integrative omics:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify emergent patterns across different data types

    • Apply machine learning for pattern recognition in complex datasets

  • Mathematical modeling:

    • Develop kinetic models of pathways involving At3g57160

    • Simulate system responses to perturbations

    • Test hypotheses in silico before experimental validation

  • Comparative systems analysis:

    • Compare stress response networks across species

    • Identify conserved and divergent components

    • Relate network architecture to ecological adaptations

  • Multi-scale modeling:

    • Connect molecular interactions to cellular and organismal phenotypes

    • Incorporate temporal and spatial dimensions into models

    • Predict emergent properties from component interactions

These approaches would help position At3g57160 within the broader context of plant stress responses and identify key nodes for experimental manipulation .

What are the current technical limitations in studying At3g57160 and how might they be overcome?

Several technical challenges currently limit comprehensive characterization of At3g57160:

  • Protein size and structural analysis:

    • Small proteins like At3g57160 can be challenging for structural determination

    • Solution: Apply advanced structural biology techniques such as cryo-EM or integrative structural biology approaches

  • Membrane association:

    • Potential membrane association complicates expression and purification

    • Solution: Develop specialized membrane protein expression systems and optimized detergent or nanodisc-based approaches

  • Functional redundancy:

    • Potential redundancy with other CYSTM family members may mask phenotypes

    • Solution: Generate higher-order mutants targeting multiple family members simultaneously

  • Transient or condition-specific interactions:

    • Some protein interactions may only occur under specific conditions

    • Solution: Develop proximity labeling approaches optimized for plant systems to capture transient interactions

  • Tissue-specific functions:

    • Functions may vary across different tissues or developmental stages

    • Solution: Implement tissue-specific or inducible expression systems for targeted manipulation

Addressing these limitations will require interdisciplinary approaches combining advanced molecular biology, biochemistry, and computational methods.

How does post-translational modification affect At3g57160 function and interactions?

While specific information about post-translational modifications (PTMs) of At3g57160 is limited in the available literature, PTMs likely play crucial roles in regulating this protein's function:

  • Potential modifications:

    • Phosphorylation: May regulate protein-protein interactions or activity

    • Ubiquitination: Could control protein stability and turnover

    • S-nitrosylation or oxidation of cysteine residues: May be particularly relevant for cysteine-rich proteins under stress conditions

    • Lipid modifications: Could affect membrane association

  • Methodological approaches:

    • Mass spectrometry-based proteomics to identify and quantify PTMs

    • Mutation of modified residues to assess functional significance

    • Phospho-mimetic and phospho-null mutations to study phosphorylation effects

    • Use of PTM-specific antibodies for detection in different conditions

  • Functional implications:

    • Stress-induced modifications may alter protein interactions or localization

    • PTMs might create condition-specific protein interaction networks

    • Sequential modifications could create regulatory switches in stress response pathways

Understanding how PTMs regulate At3g57160 would provide crucial insights into the dynamic regulation of stress responses .

How do CYSTM family proteins in Arabidopsis compare to those in other plant species?

The CYSTM protein family is found across diverse eukaryotes, suggesting important conserved functions. A comparative analysis reveals:

  • Conservation patterns:

    • The CYSTM domain is evolutionarily conserved across plants and other eukaryotes

    • Arabidopsis contains 13 CYSTM family members, whereas the number may vary in other species

    • Core structural features are likely preserved across species while specific regulatory elements may diverge

  • Functional conservation:

    • Stress response functions appear to be a conserved feature across species

    • Species-specific adaptations may exist in response to different environmental challenges

    • Both ancestral and derived functions may be present in the Arabidopsis CYSTM family

  • Methodological approaches for comparative studies:

    • Phylogenetic analysis to determine evolutionary relationships

    • Complementation studies across species to test functional conservation

    • Comparative genomics to identify regulatory element conservation

    • Analysis of selection signatures to identify adaptively evolving regions

Understanding these evolutionary relationships provides context for functional studies and can guide experimental approaches by highlighting conserved features that may be functionally important .

What can structural biology reveal about At3g57160's function and evolution?

Structural biology approaches can provide critical insights into At3g57160's function and evolution:

  • Key structural features:

    • The CYSTM domain likely has a characteristic fold that underlies its function

    • The C-terminal domain enables dimerization, suggesting specific interaction interfaces

    • The presence of an immunoglobulin-like fold in the FBA domain suggests potential roles in protein recognition

  • Structure-function relationships:

    • Structural conservation across homologs can highlight functionally critical regions

    • Mapping sequence conservation onto structural models can identify functional surfaces

    • Structural analysis of protein-protein interfaces can reveal the molecular basis of interactions

  • Methodological approaches:

    • Computational structure prediction using tools like AlphaFold or Robetta

    • Experimental structure determination via X-ray crystallography, NMR, or cryo-EM

    • Molecular dynamics simulations to study conformational dynamics

    • Structural comparison across homologs to identify conserved binding pockets or interfaces

The predicted tertiary structure of CYSTM proteins shows the presence of characteristic domains and folds that can provide insights into functional mechanisms .

What genomic and genetic resources are available for studying At3g57160?

Researchers have access to numerous resources for studying At3g57160:

  • Sequence databases and genome browsers:

    • TAIR (The Arabidopsis Information Resource): Comprehensive genomic information

    • Ensembl Plants: Comparative genomics tools and visualization

    • Phytozome: Plant comparative genomics portal

  • Expression databases:

    • Arabidopsis eFP Browser: Visualize gene expression across tissues and conditions

    • GEO (Gene Expression Omnibus): Repository of expression data

    • Expression Atlas: Gene expression across tissues, conditions, and species

  • Genetic resources:

    • T-DNA insertion lines from stock centers (ABRC, NASC)

    • CRISPR/Cas9 resources for targeted mutagenesis

    • Natural variation resources (1001 Genomes Project)

  • Protein resources:

    • UniProt: Protein sequence and functional information

    • Protein Data Bank (PDB): Structural information

    • Customized antibodies available from providers like Cusabio

These resources provide essential tools for comprehensive investigation of At3g57160's functions and regulatory mechanisms.

What funding opportunities exist for research on stress-responsive proteins like At3g57160?

Research on stress-responsive proteins like At3g57160 can be supported through various funding mechanisms:

  • University-based grants:

    • Research & Innovation Grants (RIG) provide research expenses of $3,500 for undergraduate students across all disciplines working with faculty sponsors

    • Institutional seed grants for preliminary studies

  • Government funding agencies:

    • National Science Foundation (NSF) grants for plant biology research

    • USDA National Institute of Food and Agriculture (NIFA) grants

    • Department of Energy (DOE) funding for plant science

    • European Research Council (ERC) grants for fundamental research

  • Private foundations:

    • Various plant science foundations supporting basic research

    • Agricultural industry funding for crop improvement research

  • Strategic research priorities:

    • Climate change adaptation

    • Food security initiatives

    • Sustainable agriculture programs

Researchers should align their proposals with current priorities in stress biology, climate adaptation, and sustainable agriculture to maximize funding opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.