Recombinant Arabidopsis thaliana Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petD; AtCg00730; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAAALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does PetD play in it?

The cytochrome b6-f complex is a multisubunit protein complex located in the thylakoid membrane that plays a crucial role in electron transport during photosynthesis, connecting photosystem II to photosystem I. PetD, also known as subunit 4, is an essential component of this complex. Based on molecular interaction studies, PetD contributes to the structural integrity and proper assembly of the cytochrome b6-f complex . Unlike some other interacting proteins, such as DAC (which assists in complex assembly/stabilization), PetD is an intrinsic component of the complex itself, directly participating in its core functions .

How is the PetD protein related to photosynthetic function in Arabidopsis thaliana?

PetD functions within the cytochrome b6-f complex to facilitate electron transfer in the photosynthetic electron transport chain. Disruptions in PetD expression or structure typically result in impaired photosynthetic efficiency. Specifically, studies have shown that mutations affecting PetD often lead to reduced accumulation of the entire cytochrome b6-f complex, highlighting its importance in complex assembly and stability . The protein contains transmembrane domains that anchor it within the thylakoid membrane, positioning it appropriately for interaction with other components of the photosynthetic machinery.

What conservation patterns are observed for PetD across plant species?

PetD shows high conservation from cyanobacteria to vascular plants, indicating its fundamental importance in photosynthesis throughout evolutionary history. This conservation extends to both sequence and structural elements, suggesting functional constraints on this protein. The thylakoid membrane localization and interaction patterns with assembly factors like DAC are similarly conserved . This evolutionary conservation makes PetD an excellent model for studying fundamental aspects of photosynthesis across diverse photosynthetic organisms.

What expression vectors are most effective for recombinant PetD production?

For recombinant expression of PetD, the pET vector system has proven particularly effective. The pET-21d(+) vector, which contains a T7 promoter for high-level expression, is among the most popular choices for recombinant membrane protein expression . This vector system allows for IPTG-inducible expression and often includes a C-terminal His-tag for purification purposes. For optimal results, researchers should ensure that the codon usage is optimized for the expression host, particularly when expressing plant proteins in bacterial systems.

How should E. coli expression systems be optimized for PetD production?

When expressing PetD in E. coli, several parameters require optimization:

ParameterRecommended RangeCritical Considerations
IPTG Concentration0.5-1.0 mMLower concentrations often yield better folding
Expression Temperature16-30°CLower temperatures reduce inclusion body formation
Media CompositionLB with ampicillin (100 μg/mL)Rich media can improve yield
Induction OD6000.6-0.8Early-mid log phase typically optimal
Expression Duration4-18 hoursLonger at lower temperatures

The use of ampicillin (100 μg/mL) is effective for selecting colonies harboring the expression plasmid . Testing multiple IPTG concentrations (e.g., 0.5 mM and 1.0 mM) at different temperatures is recommended to determine optimal conditions for soluble protein production, as membrane proteins like PetD can be challenging to express in properly folded forms .

What alternative expression systems might yield better results for functional PetD studies?

While E. coli is commonly used for initial recombinant protein expression, alternative systems may provide advantages for functional studies of PetD:

  • Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae offer eukaryotic post-translational modifications and membrane insertion machinery.

  • Insect cell expression: Baculovirus expression systems provide advanced eukaryotic protein processing capabilities.

  • Plant-based expression: Transient expression in Nicotiana benthamiana can preserve native folding environments for plant proteins.

  • Cell-free expression systems: Allow for direct incorporation into artificial membrane environments.

Each system offers distinct advantages depending on research goals, with plant-based systems potentially providing the most native-like environment for functional studies of photosynthetic proteins.

What purification strategies yield the highest purity and activity for recombinant PetD?

Purification of recombinant PetD requires specialized approaches due to its membrane protein nature:

  • Membrane isolation: Following cell lysis, differential centrifugation effectively separates membrane fractions containing PetD.

  • Detergent solubilization: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin effectively solubilize PetD while preserving structure.

  • Affinity chromatography: His-tagged PetD can be purified using immobilized metal affinity chromatography (IMAC), similar to approaches used for other recombinant proteins .

  • Size exclusion chromatography: A final polishing step separates properly folded proteins from aggregates.

For validation of interaction partners, surface plasmon resonance (SPR) has proven effective in confirming binding interactions for other Arabidopsis proteins .

How can researchers effectively verify the structural integrity of purified recombinant PetD?

Multiple complementary techniques should be employed to verify structural integrity:

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure content and thermal stability.

  • Limited proteolysis: Properly folded proteins show distinct proteolytic fingerprints compared to misfolded variants.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can report on tertiary structure.

  • Functional assays: Electron transfer capability in reconstituted systems provides the ultimate verification of functionality.

  • Binding assays: Interaction with known partners like DAC can confirm correct folding .

What approaches can confirm in vivo interactions of PetD with other complex components?

To verify in vivo interactions of PetD:

  • Bimolecular fluorescence complementation (BiFC): This technique has proven effective for confirming protein-protein interactions in Arabidopsis protoplasts, as demonstrated with cytochrome c partners .

  • Co-immunoprecipitation: Using antibodies against PetD or potential partners to pull down interaction complexes.

  • Crosslinking combined with mass spectrometry: Identifies proximity of proteins within complexes.

  • Yeast two-hybrid assays: Can identify direct interactions, though membrane proteins present challenges.

  • Split-ubiquitin assays: Specialized for membrane protein interactions.

For cytochrome-related proteins in Arabidopsis, affinity chromatography followed by nano-liquid chromatography tandem mass spectrometry (NanoLC-MS/MS) has successfully identified interaction partners .

How do cultivation conditions affect PetD expression and function in Arabidopsis?

Cultivation conditions significantly impact photosynthetic protein expression and function:

  • Growth media composition: Arabidopsis performs best on peat-based growing media for consistent phenotypic analysis, which is particularly important when studying photosynthetic proteins like PetD .

  • Light conditions: Light intensity and quality directly affect photosynthetic complex expression, with higher light often upregulating components of electron transport chains.

  • Temperature: Temperature impacts both gene expression and protein assembly. Studies have shown that elevated temperature affects various cellular processes in Arabidopsis, including recombination frequency .

  • Nutrient availability: Particularly iron and copper levels can affect cytochrome complex assembly.

For consistent results in photosynthetic research, standardized growth protocols are essential, as "standard laboratory protocols and growth conditions for Arabidopsis are optimized for peat-based media" .

What environmental stressors alter cytochrome b6-f complex assembly and PetD function?

Environmental stressors significantly impact cytochrome b6-f complex assembly:

  • Temperature stress: Heat stress can alter protein folding and complex assembly. Research has shown temperature-specific responses in Arabidopsis that are distinct from general stress responses .

  • Light stress: High light conditions can lead to photodamage of complexes, triggering repair mechanisms.

  • Oxidative stress: ROS can damage photosynthetic complexes, affecting PetD stability.

  • Nutrient deficiency: Particularly iron limitation impairs cytochrome complex assembly.

  • Drought stress: Affects thylakoid membrane integrity and protein interactions.

When investigating these stressors, it's important to distinguish between temperature-specific effects and general stress responses .

How can researchers standardize growth conditions for reproducible PetD studies?

For reproducible results in PetD studies:

  • Growth chamber specifications: Maintain consistent light (intensity, duration, spectrum), temperature (±0.5°C), and humidity (±5%).

  • Media standardization: Use consistent soil/media composition; for Arabidopsis, peat-based media produces most consistent physiological parameters for vegetative growth .

  • Watering protocols: Standardize watering frequency and volume to maintain consistent soil moisture.

  • Plant developmental stage: Always compare plants at identical developmental stages rather than chronological age.

  • Experimental controls: Include wild-type controls grown simultaneously under identical conditions.

The importance of standardized conditions is highlighted by research showing that "several phenotypic traits were comparable between plants cultivated on peat-based and some peat-free media... suggesting that under certain circumstances peat-free media can be suitable for phenotypic analysis of Arabidopsis" .

What methods are most effective for analyzing electron transport function of recombinant PetD?

Advanced functional analysis of PetD's electron transport capacity includes:

  • Polarographic oxygen measurements: Quantifies electron transport rates through the cytochrome b6-f complex.

  • Chlorophyll fluorescence analysis: PSII photochemistry measurements reflect downstream electron transport through the cytochrome b6-f complex.

  • Spectrophotometric cytochrome redox kinetics: Directly measures cytochrome oxidation/reduction rates.

  • Electrochemical analysis: Protein film voltammetry can assess electron transfer capabilities.

  • Reconstitution experiments: Incorporation of purified PetD into proteoliposomes or nanodiscs for functional testing.

These approaches provide complementary insights into both structural integrity and functional capacity of the recombinant protein.

How can researchers effectively create and characterize PetD mutants?

For creating and analyzing PetD mutations:

  • Site-directed mutagenesis techniques: Target specific residues based on structural information and conservation.

  • CRISPR/Cas9 genome editing: For in vivo mutation of the petD gene in Arabidopsis.

  • Complementation assays: Express mutant variants in petD knockout lines to assess function.

  • Protein stability analysis: Compare thermal stability and proteolytic resistance of wild-type and mutant proteins.

  • Comparative phenotyping: Analyze growth, photosynthetic parameters, and stress responses between wild-type and mutant plants.

When characterizing mutants, examining both protein accumulation and functional parameters is essential to distinguish between assembly defects and functional deficiencies.

What approaches can elucidate the assembly pathway of the cytochrome b6-f complex and PetD's role?

To understand the cytochrome b6-f complex assembly pathway:

  • Pulse-chase experiments: Track newly synthesized PetD through the assembly process.

  • Co-immunoprecipitation at different time points: Identify sequential interaction partners.

  • Analysis of assembly intermediates: Use native PAGE and immunoblotting to identify subcomplexes.

  • Interaction with assembly factors: Study the role of factors like DAC, which specifically interacts with PetD but is not an intrinsic component of the final complex .

  • Comparative analysis across conditions: Examine how different environmental factors affect assembly rates and efficiency.

Research on DAC has revealed that it "is a thylakoid membrane protein with two predicted transmembrane domains that is conserved from cyanobacteria to vascular plants" and "appears to be a novel factor involved in the assembly/stabilization of the cytochrome b6-f complex, possibly through interaction with the PetD protein" .

What are common challenges in recombinant PetD expression and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant PetD:

ChallengePotential Solutions
Poor expression yieldOptimize codon usage; test different E. coli strains; reduce expression temperature
Inclusion body formationExpress at lower temperatures (16-20°C); use specialized E. coli strains; add solubility tags
Protein aggregation during purificationOptimize detergent type and concentration; include stabilizing agents; maintain low temperature
Loss of structural integrityInclude appropriate cofactors; optimize buffer conditions; use mild purification techniques
Limited functional activityEnsure proper incorporation of cofactors; reconstitute in lipid environment mimicking thylakoid membrane

When working with recombinant proteins, testing multiple IPTG concentrations (e.g., 0.5 mM and 1.0 mM) at different temperatures is often necessary to determine optimal conditions .

How should researchers approach contradictory results regarding PetD function or interactions?

When facing contradictory results:

  • Evaluate methodological differences: Different expression systems, purification methods, or assay conditions can yield different results.

  • Consider post-translational modifications: The presence or absence of modifications may affect interactions and function.

  • Examine protein integrity: Partial degradation or misfolding can yield artifactual results.

  • Test interaction specificity: Use multiple complementary methods (e.g., both in vitro and in vivo approaches) to confirm interactions .

  • Validate in physiological context: Confirm findings in the native cellular environment.

The use of multiple validation techniques, as demonstrated in studies of cytochrome c partners where both bimolecular fluorescence complementation and surface plasmon resonance were applied , strengthens confidence in protein interaction data.

What statistical approaches are most appropriate for analyzing PetD expression and functional data?

For robust statistical analysis:

  • Experimental design: Include sufficient biological replicates (minimum n=3, preferably n≥5) and technical replicates.

  • Normalization methods: For gene expression, normalize to stable reference genes appropriate for the experimental conditions.

  • Statistical tests: Apply appropriate parametric (ANOVA, t-test) or non-parametric tests based on data distribution.

  • Multiple testing correction: When analyzing multiple variables or conditions, apply corrections (e.g., Benjamini-Hochberg).

  • Effect size reporting: Include not just p-values but also effect sizes and confidence intervals.

Consider multivariate approaches when analyzing complex datasets that include multiple parameters such as expression levels, photosynthetic efficiency, and growth metrics.

What aspects of PetD structure-function relationships remain to be elucidated?

Several critical knowledge gaps remain in our understanding of PetD:

How might emerging technologies advance our understanding of PetD and the cytochrome b6-f complex?

Emerging technologies with potential to advance PetD research include:

  • Cryo-electron microscopy: For high-resolution structural studies of the cytochrome b6-f complex in different functional states.

  • Single-molecule techniques: To examine kinetics and conformational changes during electron transport.

  • Proximity labeling approaches: Such as BioID or APEX to identify transient interaction partners in vivo.

  • Advanced genome editing: For precise manipulation of the petD gene and regulatory elements.

  • Synthetic biology approaches: Reconstitution of minimal functional systems to test specific hypotheses.

How can systems biology approaches integrate PetD function into broader photosynthetic networks?

Systems biology approaches for contextualizing PetD function include:

Integrating these approaches can provide a comprehensive understanding of how this critical component contributes to photosynthetic efficiency and plant fitness under varying environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.