Recombinant Arabidopsis thaliana Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Arabidopsis thaliana Cytochrome b6 (petB)

Recombinant Arabidopsis thaliana Cytochrome b6 (petB) refers to the genetically engineered protein produced through heterologous expression systems. This protein corresponds to the native cytochrome b6, a core subunit of the cytochrome b6f complex in the thylakoid membranes of chloroplasts. The recombinant form retains structural and functional properties of the native protein, enabling precise biochemical and biophysical studies of its role in photosynthetic electron transport and related processes .

Functional Roles

  1. Linear and Cyclic Electron Transport:

    • Linear Electron Transport: Transfers electrons from photosystem II (PSII) to photosystem I (PSI) via plastoquinone and plastocyanin .

    • Cyclic Electron Transport: Interacts with the NADPH dehydrogenase-like (NDH) complex to regulate ATP/NADPH balance .

  2. Proton Translocation: Generates a proton gradient across the thylakoid membrane, driving ATP synthesis .

Overexpression Studies

Transgenic Arabidopsis overexpressing the Rieske FeS protein (petC) showed elevated levels of cytochrome b6 (petB) and cytochrome f (petA), demonstrating coordinated synthesis of cytochrome b6f subunits . These plants exhibited:

ParameterWild-TypeOverexpression LineEffect
Electron Transport RateBaseline↑ 20-30%Enhanced CO₂ assimilation
Biomass YieldBaseline↑ 15-25%Increased vegetative and seed yield
PSI/PSII Protein LevelsBaseline↑ 10-20%Stabilization of photosystems

This suggests that cytochrome b6 is a rate-limiting factor in electron transport and photosynthesis .

Mutant Analysis

  • hcf164 Mutant: Defective in cytochrome b6f assembly due to a thioredoxin-like protein (HCF164) involved in subunit maturation. This led to <10% wild-type levels of cytochrome b6 and reduced PSI/PSII subunits, highlighting petB’s role in complex stability .

  • PrfB3 Mutation: Impaired petB RNA stability, reducing cytochrome b6 accumulation under stress. PrfB3 binds to petB transcripts and stabilizes them, linking environmental signals to protein levels .

Interaction Networks

Cytochrome b6 (petB) interacts with:

PartnerRoleReference
NdhSForms a complex with cytochrome b6f for cyclic electron transport
CRP1RNA-binding protein stabilizing petB mRNA

Expression Systems

Recombinant petB is typically produced in Escherichia coli or yeast, with purification via affinity chromatography. Key challenges include heme incorporation and membrane protein solubility, often addressed using fusion tags (e.g., GST, MBP) .

Experimental Uses

ApplicationMethodOutcome
Structural AnalysisX-ray crystallography/NMRElucidation of heme binding and subunit interactions
Functional AssaysElectrochemistry (e.g., plastoquinol oxidation)Determination of catalytic activity
Protein-Protein Interaction StudiesCo-IP, yeast two-hybridIdentification of partners like NdhS and CRP1

Post-Transcriptional Regulation

  • PrfB3: Binds to processed petB transcripts to stabilize them under stress, modulating cytochrome b6 levels .

  • CRP1: RNA-binding protein that protects petB mRNA from degradation, ensuring complex assembly .

Environmental Responses

Light intensity and redox signals regulate cytochrome b6f complex levels. Overexpression studies show enhanced resilience to low-light stress, suggesting potential for engineering stress-tolerant crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
petB; AtCg00720; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Gene References Into Functions
  1. DAC appears to be a novel factor involved in the assembly/stabilization of the cytochrome b(6)/f complex. PMID: 23043079
  2. Data show that PrfB3 is localized to the chloroplast stroma in a petB RNA-containing complex and found only in vascular plants. PMID: 21771930
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Cytochrome b6 in Arabidopsis thaliana?

Cytochrome b6, encoded by the petB gene, is a crucial subunit of the cytochrome b6f complex in Arabidopsis thaliana. This integral membrane protein has a molecular mass of approximately 25 kDa and is essential for photosynthetic electron transport. The cytochrome b6f complex serves as an electron transfer intermediate between photosystem II and photosystem I in the thylakoid membrane, contributing to the generation of proton motive force for ATP synthesis. The complex functions as both a monomer (approximately 140 kDa) and dimer (approximately 310 kDa) in the thylakoid membrane, with the dimeric form being predominant in functional membranes .

Unlike its counterpart in some cyanobacteria, the Arabidopsis cytochrome b6 lacks the amino-terminal extension observed in non-nitrogen-fixing unicellular cyanobacteria. The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane, where it interacts with other subunits of the cytochrome b6f complex, including PetD, to form a functional complex .

How is the cytochrome b6f complex assembled in Arabidopsis?

The assembly of the cytochrome b6f complex in Arabidopsis involves a coordinated process requiring multiple factors. Assembly begins with the synthesis of individual subunits, followed by their insertion into the thylakoid membrane and subsequent assembly into the functional complex. Several auxiliary proteins assist in this process, including DAC, which interacts specifically with the PetD subunit of the complex .

Studies using the dac mutant of Arabidopsis have shown severe defects in the accumulation of the cytochrome b6f complex, suggesting that DAC plays a critical role in the assembly or stabilization of the complex. In vivo chloroplast protein labeling experiments demonstrated that the labeling rates of PetD and cytochrome f proteins were greatly reduced in the dac mutant, while that of the cytochrome b6 protein remained normal. This indicates that DAC influences the accumulation of specific subunits of the complex, possibly by facilitating their proper assembly or preventing their degradation .

What is the role of the CCB pathway in cytochrome b6 biogenesis?

The CCB (cofactor assembly, complex C (b6f), subunit B (PetB)) pathway, also known as system IV, is a specialized heme biogenesis pathway required for the covalent binding of heme c(i)' to cytochrome b6. This pathway was initially characterized in Chlamydomonas and subsequently confirmed to operate in Arabidopsis as well .

In Arabidopsis, the CCB pathway involves at least four proteins: CCB1, CCB2, CCB3, and CCB4. Mutants lacking functional copies of these genes (ccb1, ccb2, and ccb4) exhibit a characteristic phenotype: deficiency in the accumulation of cytochrome b6f complex subunits and lack of covalent heme binding to cytochrome b6. All four CCB proteins localize to the chloroplast, as demonstrated using fluorescent protein reporters .

The CCB pathway represents a specialized system distinct from other c-type cytochrome biogenesis pathways, highlighting the complexity of post-translational modifications required for functional cytochrome assembly in photosynthetic organisms.

How do electron transport restrictions at cytochrome b6f protect photosynthetic apparatus under stress conditions?

Under abiotic stress conditions that restrict growth and development, photosynthetic organisms implement protective mechanisms to prevent photodamage. One such mechanism involves restricting electron flow at the cytochrome b6f complex when the capacity for accepting electrons downstream of Photosystem I is severely limited. This restriction represents a form of photosynthetic control that diminishes electron flow to PSI, thereby preventing PSI photodamage .

Interestingly, this protective mechanism does not appear to rely on the typical ΔpH-dependent control. Instead, when electron flow becomes restricted at the cytochrome b6f complex, the plastid alternative oxidase (PTOX) activates as an electron valve. PTOX dissipates some excitation energy absorbed by PSII and allows the formation of a proton motive force that can drive ATP production, potentially sustaining PSII repair and non-photochemical quenching (NPQ) .

Research in Chlamydomonas reinhardtii has demonstrated this phenomenon in STARCHLESS6 (sta6) mutant cells, which cannot synthesize starch when nitrogen-limited and subjected to dark-to-light transitions. The restriction at the cytochrome b6f complex can be gradually relieved with continued illumination, suggesting a dynamic regulatory mechanism that responds to changes in cellular energy status .

What are the protein-protein interactions that stabilize the cytochrome b6f complex?

The stability and function of the cytochrome b6f complex depend on specific protein-protein interactions between its subunits and with auxiliary factors. Studies using modified split-ubiquitin systems and coimmunoprecipitation analyses have revealed a specific interaction between the DAC protein and PetD, a subunit of the cytochrome b6f complex .

Despite this interaction, DAC does not comigrate with the cytochrome b6f complex in sucrose gradient sedimentation analysis, indicating that it is not an intrinsic component of the complex. Instead, DAC appears to function as an assembly/stabilization factor that interacts transiently with the cytochrome b6f complex, possibly during its biogenesis or repair .

Additional protein-protein interactions likely play roles in the stability of the complex, including interactions between the various subunits themselves. Understanding these interactions requires advanced techniques such as yeast two-hybrid assays, bimolecular fluorescence complementation, and protein crosslinking, followed by mass spectrometry analysis to identify interaction partners.

How do post-translational modifications affect cytochrome b6 function?

Post-translational modifications of cytochrome b6 are critical for its function, particularly the covalent attachment of heme groups. The CCB pathway is responsible for the covalent binding of heme c(i)' to cytochrome b6, a modification essential for electron transfer within the complex .

In Arabidopsis, mutations in CCB pathway components result in defective covalent heme binding to cytochrome b6, demonstrating the importance of this post-translational modification. The affected mutants show reduced accumulation of cytochrome b6f complex subunits, suggesting that proper heme attachment is required not only for function but also for complex stability .

Other potential post-translational modifications, including phosphorylation and redox-based modifications, may also influence cytochrome b6 function by regulating its interaction with other proteins or its electron transfer capacity. Research using advanced proteomic approaches can help identify the full complement of post-translational modifications on cytochrome b6 and elucidate their functional significance.

What are the optimal conditions for expressing recombinant Arabidopsis cytochrome b6 in its native host?

Expressing recombinant Arabidopsis cytochrome b6 in its native host offers advantages over heterologous expression systems, particularly for studies requiring proper post-translational modifications and complex formation with endogenous interaction partners. The Arabidopsis super-expression system provides a platform for preparative-scale production of homologous recombinant proteins .

For optimal expression, consider the following conditions:

  • Promoter selection: Strong constitutive promoters such as the 35S promoter from Cauliflower Mosaic Virus or inducible promoters that allow controlled expression are recommended.

  • Subcellular targeting: Include the native chloroplast transit peptide to ensure proper localization to the thylakoid membrane.

  • Affinity tags: Incorporate a small affinity tag (e.g., His-tag, FLAG-tag) at the C-terminus to facilitate purification while minimizing interference with folding and function.

  • Growth conditions: Maintain plants under moderate light intensity (100-150 μmol photons m⁻² s⁻¹) with a 16/8 hour light/dark cycle at 22°C to optimize protein expression while minimizing stress responses.

  • Harvesting time: Harvest tissue 3-4 weeks after germination when the plants have sufficient biomass but have not yet transitioned to flowering.

Using this approach, yields of up to 0.4 mg of purified protein per gram fresh weight have been reported for other recombinant proteins in Arabidopsis .

What purification strategies are most effective for isolating functional recombinant cytochrome b6?

Purifying functional recombinant cytochrome b6 requires careful consideration of its membrane-bound nature and the need to maintain protein-cofactor interactions. The following purification strategy is recommended:

Table 1: Optimized Purification Protocol for Recombinant Cytochrome b6

StepProcedureBuffer CompositionCritical Parameters
1. Membrane IsolationDifferential centrifugation50 mM HEPES-KOH pH 7.5, 330 mM sucrose, 10 mM MgCl₂, 10 mM NaCl, 1 mM PMSF, protease inhibitor cocktailMaintain samples at 4°C throughout; avoid freeze-thaw cycles
2. SolubilizationGentle detergent treatment25 mM Bis-Tris pH 7.0, 20% glycerol, 1% n-dodecyl-β-D-maltoside (DDM), 1 mM PMSFIncubate for 30 min at 4°C with gentle agitation
3. Affinity ChromatographyIMAC (for His-tagged protein)25 mM Bis-Tris pH 7.0, 20% glycerol, 0.02% DDM, 10-250 mM imidazole gradientFlow rate ≤ 0.5 ml/min; collect 0.5 ml fractions
4. Size Exclusion ChromatographySeparate monomeric/dimeric forms25 mM Bis-Tris pH 7.0, 20% glycerol, 0.02% DDMMonitor absorption at 280 nm (protein) and 420 nm (heme)

For isolating the entire cytochrome b6f complex rather than the individual cytochrome b6 subunit, sucrose gradient sedimentation can be effective. Solubilized thylakoid membranes are loaded onto a 0.1-1.0 M sucrose gradient and centrifuged at 200,000 × g for 16 hours at 4°C. The monomer and dimer forms of the complex typically migrate to positions corresponding to approximately 140 and 310 kDa, respectively .

How can researchers verify the proper assembly and function of recombinant cytochrome b6?

Verifying the proper assembly and function of recombinant cytochrome b6 requires multiple analytical approaches:

  • Spectroscopic analysis: UV-visible absorption spectroscopy can confirm the presence of properly incorporated heme groups. Cytochrome b6 exhibits characteristic absorption peaks at approximately 420 nm (Soret band) and 550-560 nm (α and β bands) in the reduced state.

  • Heme staining: TMBZ (3,3',5,5'-tetramethylbenzidine) staining of SDS-PAGE gels can detect the presence of covalently bound heme c, which should be present in properly assembled cytochrome b6.

  • Immunoblot analysis: Using antibodies specific to cytochrome b6 and other subunits of the cytochrome b6f complex can confirm the presence and relative abundance of the recombinant protein.

  • Blue native PAGE: This technique can assess whether cytochrome b6 incorporates into higher-order complexes, such as the full cytochrome b6f complex.

  • Electron transport activity: Measuring electron transport rates using artificial electron donors (such as duroquinol) and acceptors (such as methyl viologen) can assess the functional activity of the recombinant protein or complex.

  • Protein-protein interaction assays: Techniques such as the split-ubiquitin system or coimmunoprecipitation can verify interactions with known partners, such as PetD, indicating proper protein folding and assembly .

Researchers should note that proper assembly of cytochrome b6 may depend on the presence of auxiliary factors, such as the CCB proteins for heme attachment and DAC for complex stability .

What experimental approaches can assess the impact of mutations in cytochrome b6?

Experimental approaches to assess the impact of mutations in cytochrome b6 should evaluate effects on protein stability, complex assembly, and function:

  • Site-directed mutagenesis: Generate specific mutations in the petB gene, focusing on conserved residues or those implicated in heme binding, electron transfer, or protein-protein interactions.

  • Complementation studies: Transform mutant constructs into Arabidopsis lines lacking functional cytochrome b6 (petB mutants) to assess the ability of mutated versions to rescue the mutant phenotype.

  • Chlorophyll fluorescence analysis: Measure parameters such as the quantum yield of PSII (ΦII), electron transport rate (ETR), and non-photochemical quenching (NPQ) to assess the impact of mutations on photosynthetic electron transport.

  • P700 absorption measurements: Assess the redox state of PSI reaction center (P700) to determine whether mutations in cytochrome b6 affect electron flow to PSI.

  • Growth analysis: Compare growth rates, biomass accumulation, and stress responses between wild-type plants and those expressing mutant forms of cytochrome b6.

  • Structural analysis: For mutations suspected to affect protein stability or complex assembly, use techniques such as circular dichroism spectroscopy to assess secondary structure and thermal stability of the purified protein.

When interpreting results, consider that some mutations may have pleiotropic effects, impacting not only the direct function of cytochrome b6 but also the stability of the entire cytochrome b6f complex and potentially other aspects of chloroplast function .

How can researchers overcome low expression levels of recombinant cytochrome b6?

Low expression levels of recombinant cytochrome b6 can significantly hamper research progress. Several strategies can address this challenge:

  • Codon optimization: Adjust the coding sequence to match the codon usage preferences of Arabidopsis without altering the amino acid sequence, potentially improving translation efficiency.

  • Alternative promoters: Test different promoters, including tissue-specific or inducible promoters, to identify optimal expression conditions. The Arabidopsis super-expression system has demonstrated high-level expression for other recombinant proteins .

  • Co-expression of chaperones: Express molecular chaperones or assembly factors such as DAC that may facilitate proper folding and assembly of cytochrome b6 .

  • Targeted protection from degradation: Include protease inhibitors during extraction and purification steps to prevent degradation of the recombinant protein.

  • Optimized growth conditions: Adjust light intensity, temperature, and nutrient availability to maximize protein expression while minimizing stress-induced proteolysis.

Monitor protein expression levels using immunoblot analysis with antibodies specific to cytochrome b6 or to an affinity tag incorporated into the recombinant protein. Quantitative PCR can also help determine whether low protein levels result from insufficient transcription or post-transcriptional issues.

How should researchers address functional discrepancies between native and recombinant cytochrome b6?

Functional discrepancies between native and recombinant cytochrome b6 may arise from differences in post-translational modifications, protein folding, or complex assembly. To address these discrepancies:

  • Verify post-translational modifications: Confirm proper heme attachment using spectroscopic analysis and heme staining. The CCB pathway is essential for covalent heme binding to cytochrome b6, so ensure CCB genes are functional in your expression system .

  • Compare protein stability: Assess thermal stability and resistance to proteolysis between native and recombinant proteins to identify potential structural differences.

  • Examine complex formation: Use blue native PAGE and sucrose gradient sedimentation to determine whether recombinant cytochrome b6 incorporates into the cytochrome b6f complex as efficiently as the native protein .

  • Functional reconstitution: If expressing the isolated cytochrome b6 subunit, attempt reconstitution with other purified subunits of the cytochrome b6f complex to restore function.

  • In vitro versus in vivo function: Compare electron transport activity in isolated thylakoid membranes versus in intact chloroplasts or whole cells to identify context-dependent functional differences.

Document all differences systematically and consider whether they reflect artifacts of the recombinant expression system or reveal genuine insights about cytochrome b6 biogenesis and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.