Recombinant Arabidopsis thaliana Cytochrome c oxidase assembly protein COX11, mitochondrial (COX11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX11; At1g02410; T6A9.10; Cytochrome c oxidase assembly protein COX11, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
81-287
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Target Protein Sequence
STHSPSETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQRKETVEEKIAR HSESGTVTEREIVVQFNADVADGMQWKFTPTQREVRVKPGESALAFYTAENKSSAPITGV STYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILS YTFFKVSEENTTETVNNNNSVPVQETN
Uniprot No.

Target Background

Function
This protein functions in a late stage of cytochrome c oxidase synthesis, likely by facilitating the insertion of copper B into subunit I.
Database Links

KEGG: ath:AT1G02410

STRING: 3702.AT1G02410.1

UniGene: At.42604

Protein Families
COX11/CtaG (TC 3.D.4.8) family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side.

Q&A

What is the subcellular localization of Arabidopsis COX11?

Arabidopsis COX11 is an integral mitochondrial protein. This localization has been confirmed through multiple experimental approaches. Western blot analyses of cellular fractions and confocal microscopy of COX11-mRFP fusion proteins demonstrate that COX11 localizes to mitochondria. Specifically, COX11 is anchored in the inner mitochondrial membrane through a transmembrane domain located near its N-terminal end. This positioning is critical for its function in copper delivery during cytochrome c oxidase (COX) assembly .

Methodologically, researchers can confirm COX11 localization by:

  • Expressing COX11-fluorescent protein fusions (e.g., COX11-mRFP) in plants also expressing a mitochondrial marker (e.g., mt-GFP)

  • Calculating colocalization coefficients between the two fluorescent signals

  • Performing western blot analyses on purified mitochondrial fractions

  • Using bioinformatics tools like TargetP and MitoProtII to predict mitochondrial targeting probability

What structural features characterize Arabidopsis COX11?

Arabidopsis COX11 is a 287-amino acid protein with several key structural features:

  • An N-terminal cleavable mitochondrial targeting sequence

  • A single transmembrane domain (approximately 23 amino acids) near the N-terminus

  • Three conserved cysteine residues in the mature protein (after cleavage of the targeting sequence)

  • A conserved copper-binding motif (CFCF) containing cysteines C219 and C221

  • β-sheet structures in the C-terminal region similar to those in yeast COX11

These structural elements are essential for COX11's function as a copper chaperone. The conserved cysteines, particularly those in the CFCF motif, are likely involved in copper binding and transfer to the COX complex during assembly.

How does manipulation of COX11 expression affect COX activity and plant phenotypes?

Both knockdown (KD) and overexpression (OE) of COX11 in Arabidopsis significantly impact COX activity and result in distinct phenotypes:

Expression LevelEffect on COX ActivityObserved Phenotypes
Knockdown (KD)Reduced by ~50%- Root growth inhibition
- Smaller rosettes
- Leaf curling
- Reduced pollen germination
Overexpression (OE)Reduced by ~20%- Root growth inhibition
- Reduced pollen germination
- Improved growth under copper excess conditions

The reduction in COX activity directly correlates with root growth inhibition, suggesting that energy deficiency is the primary cause of this phenotype. This is supported by the fact that treatment of wild-type seedlings with KCN (a specific COX inhibitor) mimics the short-root phenotype observed in COX11 mutants .

Interestingly, OE plants show better growth compared to wild-type when exposed to excess copper, possibly because surplus COX11 can sequester excess copper and alleviate toxicity.

Why does both knockdown and overexpression of COX11 reduce COX activity?

This seemingly paradoxical finding reflects the complexity of COX assembly:

For KD plants, reduced COX11 levels directly impair COX assembly by limiting copper insertion into COX subunit 1, resulting in decreased COX activity.

For OE plants, the elevated COX11 concentration may:

  • Disturb protein stoichiometry between COX11 and its auxiliary factors

  • Deplete active forms of partner proteins (like COX19 in yeast)

  • Compete with other copper chaperones (like HCC1) for copper loading from COX17

  • Interfere with copper transfer to other subunits like COX2

This illustrates the importance of maintaining proper protein stoichiometry in multi-component assembly pathways. Researchers should consider these complexities when designing experiments that manipulate protein expression levels.

What methods are effective for generating and validating COX11 mutant lines?

Generating reliable COX11 mutant lines requires careful methodological consideration:

For knockdown approaches:

  • RNA interference (RNAi) using COX11-specific sequences

  • Artificial microRNA (amiRNA) targeting COX11

  • CRISPR-Cas9 with partial function-disrupting mutations

For overexpression:

  • CaMV 35S promoter-driven expression of the COX11 coding sequence

  • Tissue-specific promoters for targeted overexpression

Validation methods should include:

  • Quantitative PCR (qPCR) to confirm altered transcript levels

  • Western blot analysis with COX11-specific antibodies

  • Enzymatic assays to measure COX activity (e.g., cytochrome c oxidation assays)

  • Phenotypic analysis (root length, leaf morphology, pollen germination)

Researchers should be aware that T-DNA insertion lines may not always result in knockouts. As seen in the study, T-DNA insertions in the COX11 promoter region can sometimes lead to increased expression rather than knockdown .

How can researchers effectively visualize COX11 localization and function in plant cells?

Multiple complementary approaches can be employed:

  • Fluorescent protein fusions:

    • C-terminal fusion of fluorescent proteins (e.g., mRFP, GFP) to COX11

    • Co-expression with established organelle markers

    • Live cell imaging using confocal microscopy

  • Biochemical fractionation:

    • Isolation of mitochondria through differential centrifugation

    • Subfractionation to separate membrane and soluble fractions

    • Western blot analysis of fractions with COX11-specific antibodies

  • Functional complementation:

    • Expression of COX11 variants in mutant backgrounds

    • Analysis of restoration of COX activity and plant phenotypes

  • Promoter activity studies:

    • COX11 promoter:GUS fusions

    • Histochemical staining to visualize tissue-specific expression patterns

When designing fusion proteins, researchers should consider that adding tags to the N-terminus might interfere with mitochondrial targeting, while C-terminal tags could potentially affect function.

Can Arabidopsis COX11 functionally replace its homologs in other species?

Despite sharing high sequence and structural similarities, Arabidopsis COX11 cannot functionally complement the respiratory deficiency of a yeast Δcox11 strain. This functional incompatibility persists even when creating chimeric proteins with portions from both Arabidopsis and yeast COX11 .

This suggests that:

  • COX assembly requires species-specific protein-protein interactions

  • Evolutionary divergence has occurred in the COX assembly pathway

  • Sequence similarity alone is insufficient to predict functional conservation

Research approaches to investigate cross-species functionality:

  • Expression of full-length Arabidopsis COX11 in yeast Δcox11 strains

  • Creation of chimeric proteins with domains from different species

  • Testing respiratory competence through growth on non-fermentable carbon sources

  • Analysis of mitochondrial targeting efficiency in heterologous systems

These findings highlight the importance of functional testing rather than relying solely on sequence homology when studying protein function across species.

How does COX11 contribute to cellular copper homeostasis?

COX11 appears to play a significant role in copper homeostasis through multiple mechanisms:

  • Direct effects:

    • COX11 likely functions as a copper chaperone that binds copper via its conserved cysteine residues

    • It may serve as a copper buffering protein in mitochondria

  • Retrograde signaling effects:

    • Disturbance of COX11 expression triggers changes in nuclear gene expression related to copper metabolism

    • In COX11 KD lines, expression of copper homeostasis genes is altered:

      • COPT2 (plasma-membrane copper transporter) - upregulated 2-fold

      • CSD1 (copper-zinc superoxide dismutase) - upregulated 2-2.5-fold

      • ZIP2 (plasma-membrane metal-ion transporter) - downregulated 1.5-2-fold

  • Mitochondrial copper chaperone coordination:

    • COX11 disruption affects expression of other mitochondrial copper chaperones

    • HCC1 and COX17-1 are upregulated approximately 2-fold in COX11 KD lines

These findings indicate the existence of a retrograde signaling pathway from mitochondria to the nucleus that responds to disturbances in COX assembly and copper metabolism.

What experimental approaches can be used to study the copper-binding properties of COX11?

To investigate the copper-binding properties of COX11, researchers can employ several complementary approaches:

  • Recombinant protein studies:

    • Expression and purification of the soluble domain of COX11

    • Analysis of metal content using atomic absorption spectroscopy

    • UV-visible spectroscopy to detect copper-binding characteristics

    • Site-directed mutagenesis of conserved cysteine residues to confirm their role in copper binding

  • In vivo approaches:

    • Copper sensitivity/resistance assays with COX11 mutant plants

    • Measurement of copper content in isolated mitochondria from different genotypes

    • Isotope labeling with radioactive copper to track copper transfer pathways

  • Structural studies:

    • X-ray crystallography of the COX11 soluble domain with bound copper

    • Nuclear magnetic resonance spectroscopy to analyze copper coordination environment

  • Genetic approaches:

    • Double mutants of COX11 with other copper chaperones

    • Analysis of genetic interactions with copper transporters

The observation that COX11 OE plants show improved growth under copper excess conditions provides evidence for COX11's role in copper handling and suggests that it may function to sequester excess copper, potentially protecting cells from copper toxicity.

How does COX11 affect pollen development and function in Arabidopsis?

The relationship between COX11 and pollen biology in Arabidopsis reveals interesting tissue-specific functions:

  • Pollen viability:

    • Unlike in rice, where COX11 knockdown affects pollen maturation, more than 95% of pollen grains remain viable in Arabidopsis COX11 KD and OE lines

    • This suggests species-specific differences in COX11 function during pollen development

  • Pollen germination:

    • COX11 promoter shows substantial activity in germinating pollen

    • Both KD and OE plants exhibit significantly reduced pollen germination rates (by approximately 20-30%)

    • This effect can be partially mimicked by treating wild-type pollen with KCN (COX inhibitor)

  • Mechanistic explanations:

    • Energy deficiency due to reduced COX activity may partially explain the reduced germination

    • COX11 might have additional roles in pollen beyond its function in COX assembly

    • There may be a possible auxiliary role for COX11 in ROS metabolism during pollen germination

Methodologically, researchers investigating this aspect should:

  • Use fluorescein diacetate (FDA) staining to assess pollen viability

  • Conduct in vitro pollen germination assays with careful scoring criteria

  • Consider pharmacological approaches with metabolic inhibitors

  • Compare results across different plant species to identify conserved and divergent functions

What are the expression patterns of COX11 in different tissues and developmental stages?

COX11 expression patterns correlate with its function in energy production, showing highest activity in tissues with high energy demand:

  • Shoot and root meristems:

    • Areas of active cell division requiring substantial energy

    • COX11 promoter activity is prominent in these regions

  • Vascular tissues:

    • Both source and sink organs show strong expression

    • Consistent with high metabolic activity in vascular transport

  • Reproductive tissues:

    • Significant promoter activity in germinating pollen

    • Expression in developing floral structures

  • Developmental regulation:

    • Expression patterns change during plant development

    • Highest in actively growing tissues

These expression patterns can be visualized using COX11 promoter:GUS fusion constructs and histochemical staining techniques. The spatial and temporal regulation of COX11 expression provides insights into its physiological importance in tissues with high energy requirements.

How does disruption of COX11 affect the expression of other genes involved in mitochondrial function?

COX11 disruption triggers multiple transcriptional responses:

  • Other COX assembly factors:

    • COX5b-1 transcript levels increase in COX11 KD lines, possibly as a compensatory response

    • Mitochondrial copper chaperones HCC1 and COX17-1 show approximately two-fold upregulation in KD lines

  • Copper metabolism genes:

    • COPT2 (plasma-membrane copper transporter) - upregulated 2-fold in KD lines

    • CSD1 (copper-zinc superoxide dismutase) - upregulated 2-2.5-fold in all mutant lines

    • ZIP2 (plasma-membrane metal-ion transporter) - downregulated 1.5-2-fold in all mutant lines

  • Retrograde signaling:

    • Changes in nuclear gene expression indicate the presence of mitochondria-to-nucleus communication

    • This signaling appears to respond specifically to disturbances in COX assembly and copper metabolism

    • The signaling pathway may involve redox changes or metabolic alterations

These transcriptional changes highlight the existence of regulatory networks that respond to mitochondrial dysfunction, potentially to restore homeostasis. Researchers can study these responses using qPCR, RNA sequencing, or transcriptome microarrays.

What are the current gaps in our understanding of COX11 function in plants?

Several important questions remain unanswered about COX11 function:

Addressing these questions will require integrative approaches combining structural biology, biochemistry, genetics, and cell biology techniques .

What methodological challenges exist in studying mitochondrial copper chaperones?

Researchers face several technical challenges when studying COX11 and other mitochondrial copper chaperones:

  • Protein purification issues:

    • Membrane-anchored nature of COX11 complicates purification

    • Maintaining proper folding and copper binding during recombinant expression

    • Ensuring stability of the purified protein

  • Copper binding and transfer analysis:

    • Detecting transient copper transfer intermediates

    • Distinguishing specific from non-specific copper binding

    • Maintaining proper redox environment for copper coordination

  • In vivo functional assessment:

    • Difficulty in generating complete knockouts (possibly embryo-lethal)

    • Compensatory responses that mask phenotypes

    • Distinguishing direct from indirect effects of COX11 disruption

  • Localization and interaction studies:

    • Challenges in imaging proteins within mitochondria due to the small size and dynamics of these organelles

    • Potential artifacts from fluorescent protein fusions

    • Difficulty in capturing transient protein-protein interactions

Researchers can address these challenges through complementary approaches, careful experimental design, and appropriate controls to validate findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.