Recombinant Arabidopsis thaliana Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
COX3; AtMg00730; At2g07687; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGARLLSLGLIFILYTMFVW WRDVLRESTLEGHHTKVVQLGLRYGFILFIVSEVMFFFAFFWAFFHSSLAPAVEIGGIWP PKGIEVLDPWEIPFLNTLILLSSGAAVTWAHHAILAGKEKRAVYALVATVLLALVFTGFQ GMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEA AAWYWHFVDVVWLFLFVSIYWWGGI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a crucial component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain encompasses three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work synergistically to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase is the final component of the respiratory chain, catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules utilizing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Gene References Into Functions
  1. Investigation of gene arrangements and the steady state transcripts of the mitochondrially encoded cox3 gene in three different ecotypes. PMID: 16107557
Database Links

KEGG: ath:ArthMp065

STRING: 3702.ATMG00730.1

UniGene: At.47771

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 3 (COX3) in Arabidopsis thaliana and why is it significant?

Cytochrome c oxidase subunit 3 (COX3) is a mitochondrially encoded protein that forms an essential component of the respiratory electron transport chain in Arabidopsis thaliana. It functions as one of the core subunits of Complex IV (cytochrome c oxidase), the terminal enzyme of the respiratory chain that catalyzes the reduction of oxygen to water. The significance of COX3 extends beyond its basic role in cellular respiration. As a mitochondrially encoded gene, COX3 provides valuable insights into organellar genome function, cyto-nuclear co-adaptation, and the evolution of mitochondrial genes in plants. The study of COX3 in A. thaliana is particularly valuable because this model organism offers exceptional genetic resources for understanding fundamental biological processes in plants .

What techniques are commonly used to study COX3 gene expression?

Multiple molecular biology techniques are employed to study COX3 gene expression in Arabidopsis thaliana. Northern and Southern hybridization analyses are fundamental approaches to investigating transcript abundance and genomic organization, respectively. For Southern blot analysis, typically 10 μg of total DNA is digested with restriction enzymes such as HindIII, followed by size fractionation on agarose gels and hybridization using labeled DNA probes . These probes can be generated through PCR amplification of specific regions, such as the COX3 N-terminal region (positions 3-232 with respect to the ATG) using appropriate primers . Probe labeling is commonly performed using methods like random prime labeling with radiolabeled nucleotides . For mitochondrial DNA-specific analyses, purified mtDNA libraries can be established and screened after colony transfer to appropriate membranes . Additionally, more contemporary approaches including quantitative RT-PCR, RNA-Seq, and various next-generation sequencing techniques offer higher sensitivity for transcript detection and a more comprehensive view of expression patterns across different tissues and developmental stages.

How are recombinant versions of A. thaliana COX3 typically produced for research?

Recombinant Arabidopsis thaliana COX3 protein can be produced using various heterologous expression systems, with Escherichia coli being one of the most common platforms. Typically, the full-length COX3 coding sequence (corresponding to amino acids 1-265) is cloned into an appropriate expression vector that incorporates an affinity tag, such as a polyhistidine (His) tag, to facilitate purification . The His tag is commonly fused to either the N-terminus or C-terminus of the protein, with N-terminal fusion being more frequently reported . After transformation into an E. coli expression strain, protein production is induced under optimized conditions that balance yield with proper folding. Following cell lysis, the recombinant protein can be purified using affinity chromatography, typically with nickel or cobalt resins that bind the His tag. Additional purification steps often include ion exchange chromatography, size exclusion chromatography, or both to achieve high purity. It is important to note that as a membrane protein naturally residing in the mitochondrial inner membrane, COX3 presents specific challenges for heterologous expression, including potential toxicity to host cells, insolubility, and improper folding. Therefore, optimization of expression conditions, use of specialized E. coli strains, and inclusion of solubilizing agents may be necessary to obtain functional recombinant protein.

What evidence exists for cyto-nuclear co-adaptation involving mitochondrial genes like COX3?

Compelling evidence suggests that cyto-nuclear co-adaptation plays a crucial role in mitochondrial function in Arabidopsis thaliana, likely involving genes like COX3. Studies examining the diversity of plastid and mitochondrial genomes among A. thaliana accessions have revealed significant congruence between mitochondrial and plastid phylogenies, suggesting coordinated evolution of these organellar genomes . This co-evolution extends to interactions with the nuclear genome. Experimental evidence for cyto-nuclear co-adaptation comes from studies testing germination capacity in challenging conditions using reciprocal F2 families, which found that the cytoplasm donor had a significant effect on germination in some F2 families . These findings suggest that optimal mitochondrial function depends on compatible combinations of mitochondrial and nuclear genes. In animals, examples of compensatory co-adaptation between mitochondrial and nuclear-encoded respiratory complex subunits have been documented through interspecies studies, and researchers have emphasized that the importance of mitochondrial-nuclear interactions in evolutionary processes has likely been underestimated . For mitochondrial proteins like COX3, which interact with nuclear-encoded subunits in the respiratory complex, such co-adaptation is particularly relevant. Understanding these interactions is essential for interpreting the functional consequences of genetic variation in mitochondrial genes and for designing experiments that involve transferring genetic material between different ecotypes or species.

How do COX3 transcript characteristics differ between A. thaliana ecotypes?

The characteristics of COX3 transcripts show notable differences between Arabidopsis thaliana ecotypes, primarily in their 5' end formation. Detailed analyses of the Columbia (Col), C24, and Landsberg erecta (Ler) ecotypes have revealed that while the 3' regions of the transcripts are conserved, the 5' ends exhibit ecotype-specific patterns . These differences correlate with variations in the far upstream sequences beyond position -584 relative to the start codon. Interestingly, these upstream sequence differences influence the generation of 5' transcript ends located approximately 140 nucleotides downstream, in regions that are identical across all three ecotypes . This suggests that distant upstream elements play regulatory roles in transcript processing or stability. Northern blot analyses have been used to characterize these transcripts, revealing variations in abundance and possibly in processing efficiency between ecotypes . These ecotype-specific transcript characteristics may have functional consequences, potentially affecting translation efficiency, transcript stability, or regulatory responses. Understanding these differences is crucial for researchers working with COX3, as the choice of ecotype could significantly impact experimental outcomes. Additionally, these observations highlight the complex nature of mitochondrial gene expression regulation in plants and the importance of considering genomic context when studying individual genes.

What methodological approaches can resolve data inconsistencies in COX3 functional studies?

Resolving data inconsistencies in COX3 functional studies requires a multi-faceted methodological approach that accounts for genetic background effects, environmental influences, and technical variations. One powerful strategy involves using multiple Arabidopsis thaliana recombinant inbred (RI) populations to analyze COX3 function across diverse genetic backgrounds . These "immortal" mapping populations enable repeated experiments under varied conditions, allowing researchers to distinguish consistent phenotypic effects from background-dependent variations . For example, using six or more different RI populations, as demonstrated in quantitative trait loci (QTL) studies, can reveal whether COX3 functional effects are universal or dependent on specific genetic interactions .

Technical approaches to resolve inconsistencies should include:

  • Standardized growth and measurement protocols across laboratories to minimize environmental variation

  • Development of comprehensive linkage maps anchored to the A. thaliana genome sequence to accurately position genetic markers

  • Implementation of multiple complementary techniques to assess COX3 function, such as:

    • Respiration measurements using oxygen electrodes

    • Blue Native PAGE analysis of respiratory complex assembly

    • In vivo mitochondrial functional assays using fluorescent probes

    • Proteomic analyses of mitochondrial protein complexes

Additionally, creating cybrids (cytoplasmic hybrids) where the mitochondrial genome from one ecotype is combined with the nuclear genome of another can directly test cyto-nuclear interactions affecting COX3 function . These experiments are particularly valuable given the evidence for co-adaptation between mitochondrial and nuclear genomes in A. thaliana . Finally, comparative studies across multiple ecotypes with known genomic variations in the COX3 region can help correlate specific sequence features with functional outcomes .

How can advanced genomic tools be used to study COX3 regulation in the context of mitochondrial-nuclear interactions?

Advanced genomic tools offer powerful approaches to unravel the complex regulation of COX3 in the context of mitochondrial-nuclear interactions in Arabidopsis thaliana. A comprehensive strategy begins with whole-genome sequencing across multiple ecotypes to identify both nuclear and mitochondrial variations potentially affecting COX3 expression and function. This approach has already revealed significant diversity in plastid and mitochondrial genomes among A. thaliana accessions, forming the basis for understanding organellar genome evolution and co-adaptation with nuclear genes .

RNA-seq analysis of both nuclear and mitochondrial transcriptomes can identify co-regulated gene networks spanning both genomes. For COX3 specifically, differential expression analysis under various stress conditions can reveal how nuclear factors modulate mitochondrial gene expression in response to environmental changes. CRISPR/Cas9-based approaches modified for organelle targeting could potentially allow precise editing of COX3 regulatory regions to test hypotheses about transcript processing and stability .

To study protein-level interactions, techniques like proximity labeling (BioID) or IP-MS (immunoprecipitation coupled with mass spectrometry) with tagged nuclear-encoded respiratory complex subunits can identify direct protein partners of COX3. Quantitative proteomics across ecotypes with known differences in COX3 genomic structure can reveal how these variations affect protein abundance and complex assembly.

Statistical parsimony methods similar to those used to build phylogenetic networks of haplotype groups for mitochondrial and plastid genomes can be applied to analyze the co-evolution of nuclear and mitochondrial genes involved in respiratory functions. Finally, reciprocal F2 family analysis with specific focus on respiratory phenotypes can directly test the functional consequences of different nuclear-mitochondrial combinations .

What are the optimal experimental designs for studying the role of recombinant COX3 in respiratory complex assembly?

Designing optimal experiments to study recombinant Arabidopsis thaliana COX3's role in respiratory complex assembly requires careful consideration of protein characteristics and experimental systems. Since COX3 is a membrane protein with multiple transmembrane domains, traditional in vitro assembly assays may not fully recapitulate the native assembly environment. Instead, a combination of in vivo and in vitro approaches provides the most comprehensive understanding.

A recommended experimental design would include:

  • In vitro reconstitution studies:

    • Express recombinant full-length COX3 protein (amino acids 1-265) with an affinity tag

    • Incorporate the purified protein into liposomes or nanodiscs with defined lipid composition

    • Add purified nuclear-encoded subunits in a stepwise manner

    • Monitor assembly using FRET, native gel electrophoresis, or electron microscopy

  • Cell-free expression systems:

    • Utilize wheat germ or insect cell-based cell-free systems that provide appropriate membrane insertion machinery

    • Co-express COX3 with other cytochrome c oxidase subunits

    • Analyze complex formation using Blue Native PAGE and activity assays

  • Yeast complementation:

    • Express A. thaliana COX3 in Saccharomyces cerevisiae cox3 mutants

    • Assess respiratory function through growth on non-fermentable carbon sources

    • Analyze complex assembly through mitochondrial isolation and protein analysis

  • Plant-based assays:

    • Generate transgenic A. thaliana lines expressing tagged versions of COX3

    • Use inducible RNA interference to downregulate endogenous COX3

    • Employ time-course experiments to monitor complex assembly dynamics

    • Analyze mitochondrial function through respiration measurements and metabolic profiling

For all approaches, it's crucial to include appropriate controls and to verify that the recombinant protein maintains native structural characteristics. Comparison across multiple A. thaliana ecotypes with known variations in COX3 genomic regions can provide additional insights into structure-function relationships. Integration of data from these complementary approaches will provide a comprehensive understanding of COX3's role in respiratory complex assembly.

How can recombinant COX3 be used to study evolutionary adaptations in plant respiratory function?

Recombinant Cytochrome c oxidase subunit 3 (COX3) offers a powerful tool for investigating evolutionary adaptations in plant respiratory function. By producing recombinant versions of COX3 from different Arabidopsis thaliana ecotypes and related species, researchers can directly compare functional properties and identify adaptive changes. The available information on cytoplasmic phylogeny in A. thaliana provides an excellent framework for these evolutionary studies . Researchers have already established phylogenetic networks of haplotype groups for both plastid and mitochondrial genomes, revealing highly congruent evolutionary histories that can be combined into a single cytoplasmic phylogeny .

A systematic approach would involve expressing recombinant COX3 proteins from multiple A. thaliana ecotypes with known geographic and evolutionary relationships. This could be extended to include close relatives such as Arabidopsis lyrata and Arabidopsis arenosa, which have been used to root phylogenetic networks . Functional assays measuring enzyme kinetics, oxygen affinity, proton pumping efficiency, and response to inhibitors could reveal adaptations related to different environmental conditions at the original collection sites.

The genomic variation observed in the upstream regions of COX3 between ecotypes Columbia, C24, and Landsberg erecta suggests potential regulatory adaptations . By incorporating these regulatory regions into expression constructs, researchers could study how evolutionary changes in non-coding sequences influence COX3 expression patterns and efficiency. Additionally, by analyzing the co-variation between COX3 sequences and interacting nuclear-encoded subunits across ecotypes, researchers can identify potentially co-adapted residues, providing insights into the molecular basis of cyto-nuclear co-adaptation that has been experimentally observed in A. thaliana .

What experimental protocols are most effective for studying the impact of environmental stressors on COX3 function?

Investigating the impact of environmental stressors on COX3 function in Arabidopsis thaliana requires carefully designed experimental protocols that integrate molecular, biochemical, and physiological approaches. Effective experimental designs should account for the genetic diversity present in different A. thaliana ecotypes, as cytoplasmic variation has been linked to adaptive responses .

A comprehensive experimental protocol should include:

  • Plant growth under controlled stress conditions:

    • Use growth chambers to apply precise temperature, drought, salinity, or oxidative stress treatments

    • Include multiple ecotypes with known variations in COX3 genomic regions

    • Design time-course experiments to capture both immediate and acclimation responses

    • Maintain unstressed controls under identical conditions except for the stress variable

  • Mitochondrial function assessment:

    • Isolate intact mitochondria using Percoll gradient centrifugation

    • Measure oxygen consumption rates using Clark-type electrodes or plate-based respirometry

    • Determine membrane potential using fluorescent probes

    • Assess ROS production using specific fluorescent indicators

    • Measure COX activity using cytochrome c oxidation assays

  • Molecular analyses:

    • Quantify COX3 transcript abundance using RT-qPCR

    • Map transcript 5' and 3' ends using rapid amplification of cDNA ends (RACE)

    • Analyze protein levels using western blotting with specific antibodies

    • Assess complex assembly using Blue Native PAGE

    • Perform whole cell proteomics to identify stress-induced changes in the mitochondrial proteome

  • Genetic manipulation:

    • Generate transgenic plants with altered COX3 expression

    • Create plants expressing recombinant COX3 variants fused to reporter tags

    • Use reciprocal F2 families to test cytoplasmic effects on stress responses

This multi-faceted approach allows researchers to correlate stress-induced changes in COX3 expression, processing, and function with whole-plant physiological responses. The use of recombinant inbred populations provides powerful tools for mapping stress response QTLs that might interact with COX3 function. By integrating data across these different experimental levels, researchers can build comprehensive models of how mitochondrial genes like COX3 contribute to plant stress adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.