Recombinant Arabidopsis thaliana Cytochrome P450 72C1 (CYP72C1)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome P450 monooxygenases (P450s) are a diverse superfamily of enzymes present in nearly all organisms and are known for their roles in the metabolism of a wide variety of compounds . In plants, P450s participate in an array of biochemical pathways, including the biosynthesis of hormones, secondary metabolites, and detoxification of xenobiotics . Arabidopsis thaliana CYP72C1 is a member of the cytochrome P450 family. CYP72C1 has been identified as a brassinosteroid-inactivating enzyme that is important for steroid-mediated signal transduction in Arabidopsis thaliana . Genetic analyses have indicated that P450s modulate growth throughout plant development .

Gene and Protein Structure

The CYP72C1 gene is located on chromosome 1 of Arabidopsis thaliana (locus AT1G17060) . CYP72C1 shares 36% amino acid identity with BAS1 (CYP734A1), another cytochrome P450 . CYP71B7 is another cytochrome P450 sequence from Arabidopsis thaliana . The CYP71B7 gene likely exists as a single copy in the genome of A. thaliana .

Biochemical Activity and Function

The biochemical activity of CYP72C1 was unknown, but CYP72C1 was predicted to function in a unique BR inactivation step that is distinct from that of BAS1 .

Three-dimensional models indicated that the active site of CYP72C1 does not contain several conserved amino acids typically needed for substrate hydroxylation . Substrate binding analyses have indicated that CYP734A1 binds active brassinosteroids, brassinolide and castasterone, as well as their upstream precursors whereas CYP72C1 binds precursors more effectively .

Role in Brassinosteroid Metabolism

CYP72C1 and CYP734A1 have been identified as brassinosteroid-inactivating enzymes important for steroid-mediated signal transduction in Arabidopsis thaliana . BAS1 encodes a cytochrome P450 (CYP734A1), and this hydroxylase is involved in the conversion of castasterone (CS) and BL to their C-26-hydroxylated compounds . The bas1D mutant showed reduced hypocotyl lengths due to a decrease in bioactive BR levels . Activation of the cytochrome P450 gene, CYP72C1, reduces the levels of active brassinosteroids in vivo .

CYP72C1, together with BAS1/CYP72B1, is speculated to regulate active brassinosteroid levels in plants, and expression analysis suggested that wild-type CYP 72C1 transcript levels increased after exposure to white light, although the physiological significance of such a response remains obscure .

Mutant Studies and Phenotypes

The shrinked1- D (shk1- D) mutant is caused by activation of the CYP72C1 gene . These results suggested that CYP72C1 reduced endogenous levels of BRs and may also reduce BL . Overexpression of CYP72C1 causes a dwarf phenotype resembling brassinolide deficiency .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYP72C1; CHI2; DLF; SHK1; SOB7; At1g17060; F20D23.24; Cytochrome P450 72C1; Protein CHIBI 2; Protein DWARFISH WITH LOW FERTILITY; Protein SHRINK 1; Protein SUPPRESSOR OF PHYB-4 PROTEIN 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-519
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYP72C1
Target Protein Sequence
MLEIITVRKVFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRE SNQMDQVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIM SKHELFPKPKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEM LEEWERLASAKGTMELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAI RAVYIPGSKFLPTKFNRRLRETERDMRAMFKAMIETKEEEIKRGRGTDKNSDLLFSMLAS NTKTIKEQGPDSGLSLDDLIDDCKAFYLAGQNVTSSLFVWTLVALSQHQDWQNKARDEIS QAFGNNEPDFEGLSHLKVVTMILHEVLRLYSPAYFTCRITKQEVKLERFSLPEGVVVTIP MLLVHHDSDLWGDDVKEFKPERFANGVAGATKGRLSFLPFSSGPRTCIGQNFSMLQAKLF LAMVLQRFSVELSPSYTHAPFPAATTFPQHGAHLIIRKL
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana Cytochrome P450 72C1 (CYP72C1) is an atypical cytochrome P450 enzyme involved in brassinosteroid (BR) inactivation and the regulation of BR homeostasis. Unlike other enzymes that have carbon 26 hydroxylase activity, CYP72C1 may inactivate BRs through hydroxylation at carbons other than C-26. It functions in conjunction with CYP734A1 to inactivate BRs and modulate photomorphogenesis.
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in hypocotyls, roots, cotyledons, stamens and silique junctions.

Q&A

How does CYP72C1 differ from other cytochrome P450 enzymes involved in brassinosteroid metabolism?

CYP72C1 exhibits several unique characteristics that distinguish it from other brassinosteroid-metabolizing P450s:

  • Substrate preference: While CYP734A1 binds and acts upon active brassinosteroids (brassinolide and castasterone), CYP72C1 binds brassinosteroid precursors more effectively than active brassinosteroids .

  • Active site structure: Three-dimensional modeling has revealed that CYP72C1's active site lacks several conserved amino acids typically needed for substrate hydroxylation that are present in other P450s .

  • Response to brassinolide: Unlike BAS1/CYP734A1, CYP72C1 expression is not altered by the application of exogenous brassinolide .

  • Light response: Wild-type CYP72C1 transcript levels increase after exposure to white light, a response not typically observed in other brassinosteroid-metabolizing P450s .

These differences suggest that while there may be some functional overlap with other P450s, CYP72C1 has evolved distinct biochemical mechanisms for fine-tuning brassinosteroid hormone levels in Arabidopsis.

What phenotypes are associated with altered CYP72C1 expression?

Overexpression of CYP72C1 results in characteristic phenotypes that reflect disrupted brassinosteroid signaling:

Phenotypic FeatureDescriptionObserved in Mutant
Plant heightSevere dwarfismchi2, shk1-D
Hypocotyl lengthShort hypocotyls in both light and dark conditionschi2, shk1-D
Leaf morphologyDark green, rounded epinastic leaveschi2
Reproductive structuresShort petioles and siliquesshk1-D
Seed morphologySeeds shortened along the longitudinal axisshk1-D
FertilityReduced male fertilitychi2

These phenotypes closely resemble those of brassinosteroid-deficient mutants such as det2, cpd, and dwf4 . Importantly, the hypocotyl phenotype can be restored by adding brassinolide to the culture medium, confirming that these characteristics are directly related to brassinosteroid deficiency caused by CYP72C1 overexpression .

What is the biochemical mechanism by which CYP72C1 inactivates brassinosteroids?

While the precise biochemical mechanism remains to be fully elucidated, current research provides several insights:

CYP72C1 appears to act primarily on brassinosteroid precursors rather than on active brassinosteroids such as brassinolide . Three-dimensional modeling of the enzyme has revealed that its active site lacks several conserved amino acids typically required for substrate hydroxylation . This atypical active site structure suggests that CYP72C1 may employ a different catalytic mechanism than other brassinosteroid-metabolizing P450s.

Heterologous expression studies followed by substrate binding analyses demonstrate that CYP72C1 binds brassinosteroid precursors more effectively than the active brassinosteroids brassinolide and castasterone . In plants overexpressing CYP72C1, endogenous levels of castasterone, 6-deoxocastasterone, and 6-deoxotyphasterol are altered , suggesting these compounds may be direct or indirect targets of CYP72C1 activity.

To conclusively determine the exact biochemical reaction catalyzed by CYP72C1, future research should focus on in vitro enzyme assays with purified recombinant CYP72C1 and various brassinosteroid intermediates, followed by comprehensive metabolite profiling using liquid chromatography-mass spectrometry (LC-MS).

How does CYP72C1 interact with the broader brassinosteroid signaling network?

CYP72C1 appears to be integrated into the brassinosteroid signaling network through several mechanisms:

  • Feedback regulation: Unlike BAS1/CYP734A1, CYP72C1 expression is not regulated by exogenous brassinolide levels , suggesting it may be part of a separate regulatory circuit within the brassinosteroid signaling network.

  • Light signaling integration: CYP72C1 transcript levels increase after exposure to white light , indicating potential cross-talk between light signaling and brassinosteroid pathways.

  • Downstream gene expression: CYP72C1 overexpression alters the expression of known brassinosteroid-responsive genes, including CPD, TCH4, and BAS1 . This suggests that CYP72C1 activity impacts the core brassinosteroid signaling pathway and its downstream transcriptional responses.

Understanding these interactions more fully would require techniques such as yeast two-hybrid assays, co-immunoprecipitation studies, and chromatin immunoprecipitation sequencing (ChIP-seq) to identify direct protein-protein interactions and transcriptional regulatory networks.

What is the evolutionary significance of CYP72C1 in plant hormone metabolism?

The cytochrome P450 superfamily is one of the largest and most diverse gene families in plants, with 244 genes and 28 pseudogenes identified in the Arabidopsis genome alone . This diversification appears to mirror the complexity of plant metabolism, with limited functional redundancy between family members .

The CYP72 family, to which CYP72C1 belongs, contains enzymes that sometimes share less than 20% sequence identity yet catalyze diverse reactions involved in hormone biosynthesis and catabolism . This suggests that CYP72C1 may have evolved from gene duplication events followed by neofunctionalization to acquire its current role in brassinosteroid metabolism.

Comparative genomic and phylogenetic analyses across plant species could provide further insights into the evolutionary history and functional diversification of CYP72C1 and related enzymes.

What are the best approaches for generating and validating recombinant CYP72C1 for in vitro studies?

Producing functional recombinant CYP72C1 requires careful consideration of expression systems and purification strategies:

  • Expression system selection:

    • Bacterial systems: E. coli is commonly used but often results in insoluble or inactive plant P450s due to lack of proper folding machinery and heme incorporation.

    • Yeast systems: S. cerevisiae or P. pastoris can provide better folding and post-translational modifications.

    • Insect cell systems: Baculovirus-infected insect cells often yield higher amounts of properly folded and active plant P450s.

    • Plant cell cultures: May provide the most native-like environment for expression.

  • Construct design considerations:

    • Include the full-length CYP72C1 sequence, including any N-terminal membrane anchor

    • Consider adding a C-terminal His-tag for purification

    • For improved solubility, test N-terminal modifications or truncations of the membrane anchor region

  • Validation methods:

    • Spectral analysis: Characteristic CO-difference spectrum with a peak at 450 nm confirms properly folded P450

    • Substrate binding assays: Evaluate binding of potential brassinosteroid substrates through spectral shifts

    • Activity assays: Measure substrate conversion using LC-MS or similar analytical techniques

    • Kinetic parameters: Determine Km and kcat values for different substrates

Based on research with CYP72C1 and related P450s, heterologous expression in insect cells or yeast, followed by membrane fraction isolation, appears to be the most promising approach for obtaining functional enzyme for biochemical characterization .

How should experiments be designed to analyze CYP72C1's impact on brassinosteroid metabolism in planta?

To comprehensively analyze CYP72C1's role in brassinosteroid metabolism, a multi-faceted experimental approach is recommended:

These experimental approaches should be integrated to build a comprehensive understanding of CYP72C1's role in brassinosteroid homeostasis and plant development.

What specialized techniques are required for studying the structure-function relationship of CYP72C1?

Investigating the structure-function relationship of CYP72C1 requires advanced techniques from structural biology, molecular modeling, and protein engineering:

  • Structural determination approaches:

    • X-ray crystallography: The gold standard for determining protein structure, though membrane-associated P450s can be challenging to crystallize

    • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane proteins that resist crystallization

    • Nuclear magnetic resonance (NMR) spectroscopy: Useful for studying protein dynamics and substrate interactions

  • Computational modeling techniques:

    • Homology modeling: Based on structural templates from related P450s

    • Molecular dynamics simulations: To understand protein flexibility and substrate interactions

    • Docking studies: To predict binding modes of various brassinosteroid substrates

  • Site-directed mutagenesis strategy:

    • Target the atypical active site residues identified in CYP72C1

    • Create mutations that potentially restore canonical P450 active site features

    • Design mutations to alter substrate specificity based on computational predictions

  • Functional validation of structural hypotheses:

    • Enzyme kinetics with wild-type and mutant proteins

    • Binding assays to quantify changes in substrate affinity

    • Product analysis to identify altered reaction outcomes

Particular attention should be paid to the active site of CYP72C1, which lacks several conserved amino acids typically needed for substrate hydroxylation . Comparing the structure and function of CYP72C1 with the better-characterized CYP734A1 could provide valuable insights into their different mechanisms of brassinosteroid inactivation.

How can researchers reconcile seemingly contradictory data on CYP72C1 function across different studies?

When analyzing apparently contradictory findings regarding CYP72C1 function, researchers should consider several key factors:

  • Genetic background variations:

    • Different Arabidopsis ecotypes may show varied responses to CYP72C1 manipulation

    • The presence of other genetic modifications in experimental lines could affect outcomes

    • Consider testing phenotypes in multiple genetic backgrounds

  • Expression level considerations:

    • Overexpression using different promoters may result in varying protein levels

    • Activation tagging (as in chi2 and shk1-D mutants) may produce different expression patterns than transgenic overexpression

    • Quantify CYP72C1 transcript and protein levels across different studies for proper comparison

  • Experimental condition differences:

    • Light conditions significantly impact CYP72C1 expression and brassinosteroid signaling

    • Growth medium composition, particularly exogenous hormones, may alter results

    • Temperature, humidity, and other environmental factors should be standardized

  • Methodological approach variations:

    • In vitro binding studies may not perfectly reflect in vivo substrate preferences

    • Different analytical methods for brassinosteroid quantification vary in sensitivity and specificity

    • Consider using multiple independent techniques to validate key findings

A systematic meta-analysis approach, replicating key experiments under standardized conditions, and directly comparing CYP72C1 mutant lines from different studies side-by-side would help resolve apparent contradictions in the literature.

What analytical challenges exist in measuring the impact of CYP72C1 on brassinosteroid metabolites?

Measuring brassinosteroid metabolites in plant tissues presents several significant analytical challenges:

  • Low abundance issues:

    • Brassinosteroids typically exist at picogram to nanogram levels per gram of plant tissue

    • This requires highly sensitive analytical instruments and careful sample preparation

    • Consider using isotope-labeled internal standards for accurate quantification

  • Structural similarity complications:

    • Many brassinosteroid intermediates have similar structures and chemical properties

    • Chromatographic separation must be optimized to distinguish closely related compounds

    • Multiple reaction monitoring (MRM) in LC-MS/MS can improve specificity

  • Tissue-specific and developmental variations:

    • Brassinosteroid levels vary significantly between tissues and developmental stages

    • Microdissection or tissue-specific extraction may be necessary

    • Developmental time courses should be carefully controlled

  • Metabolic flux considerations:

    • Static measurements may miss dynamic changes in metabolite flux

    • Consider pulse-chase experiments with labeled precursors

    • Mathematical modeling of metabolic networks can help interpret flux data

A comprehensive analytical strategy would combine targeted and untargeted metabolomics, potentially including:

  • Gas chromatography-mass spectrometry (GC-MS) for volatile derivatives

  • Liquid chromatography-high resolution mass spectrometry (LC-HRMS) for intact compounds

  • Isotope dilution methods for absolute quantification of key metabolites

How should researchers interpret the evolutionary and functional relationship between CYP72C1 and other plant P450 enzymes?

Interpreting the evolutionary and functional relationships between CYP72C1 and other plant P450 enzymes requires a multifaceted approach:

  • Phylogenetic analysis interpretation:

    • Compare CYP72C1 with closely related CYP72 family members and more distant P450s

    • Examine conservation patterns across plant species and correlate with known physiological roles

    • Consider both sequence similarity and substrate specificity in defining functional groups

  • Structural homology assessment:

    • Despite low sequence identity (sometimes <20%), P450s maintain structural conservation

    • Focus on active site architecture when comparing functional similarities

    • CYP72C1's atypical active site may represent an evolutionary innovation for specialized function

  • Functional redundancy evaluation:

    • Arabidopsis contains 244 P450 genes, but with surprisingly limited functional redundancy

    • Examine phenotypes of single and multiple P450 mutants to assess overlapping functions

    • Compare expression patterns across tissues and developmental stages

  • Regulatory network positioning:

    • Analyze how different P450s are integrated into broader metabolic and signaling networks

    • CYP72C1's light-responsive expression suggests integration with photomorphogenic pathways

    • Unlike BAS1/CYP734A1, CYP72C1 is not regulated by brassinolide , suggesting distinct regulatory mechanisms

Researchers should consider that while the Arabidopsis P450 family underwent substantial diversification, this appears to mirror the complexity of plant metabolism rather than creating redundancy . CYP72C1 likely evolved to fulfill a specific role in regulating brassinosteroid homeostasis in particular tissues or developmental contexts.

What emerging technologies could advance our understanding of CYP72C1 function?

Several cutting-edge technologies hold promise for elucidating CYP72C1 function:

  • CRISPR-based approaches:

    • Base editing for introducing specific mutations without double-strand breaks

    • Prime editing for precise nucleotide replacements to study structure-function relationships

    • CRISPR interference (CRISPRi) for tissue-specific or inducible repression of CYP72C1

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize CYP72C1 subcellular localization

    • Förster resonance energy transfer (FRET) to study protein-protein interactions

    • Stimulated Raman scattering (SRS) microscopy for label-free imaging of brassinosteroid distribution

  • Single-cell omics:

    • Single-cell RNA-seq to identify cell-specific transcriptional responses to CYP72C1 activity

    • Spatial transcriptomics to map expression patterns with tissue context

    • Single-cell metabolomics to capture cell-specific brassinosteroid profiles

  • Computational approaches:

    • Machine learning for predicting P450 substrate specificity based on sequence

    • Integrated multi-omics data analysis to position CYP72C1 in broader metabolic networks

    • Molecular dynamics simulations with enhanced sampling to study substrate binding and catalysis

These emerging technologies could help overcome current limitations in understanding CYP72C1's precise biochemical function, its regulation in specific cellular contexts, and its integration into plant development and environmental response pathways.

How might CYP72C1 research inform broader understanding of plant hormone homeostasis?

CYP72C1 research provides a valuable model system for understanding fundamental aspects of plant hormone homeostasis:

  • Metabolic gating mechanisms:

    • CYP72C1 appears to act on brassinosteroid precursors rather than active hormones

    • This suggests a regulatory strategy focused on limiting hormone production rather than degrading active compounds

    • Similar strategies may exist for other hormone pathways

  • Signal integration nodes:

    • CYP72C1 expression increases after light exposure , demonstrating cross-talk between light and hormone signaling

    • Understanding how CYP72C1 is regulated may reveal mechanisms for environmental modulation of hormone levels

    • These principles could extend to other hormone systems responding to environmental cues

  • Evolutionary diversification patterns:

    • The distinct properties of CYP72C1 and CYP734A1, despite their similar roles in brassinosteroid regulation , illustrate how parallel pathways evolve

    • This may represent a common pattern in hormone metabolism, where multiple regulatory enzymes with distinct properties provide robust and nuanced control

  • Biotechnological applications:

    • Understanding CYP72C1's precise mechanism could enable targeted engineering of brassinosteroid metabolism

    • The principles learned could inform strategies for modulating other hormone pathways to improve crop traits

By deeply investigating the unique properties of CYP72C1, researchers can uncover generalizable principles about how plants maintain hormone homeostasis across developmental stages and in response to environmental changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.