Recombinant Arabidopsis thaliana Cytochrome P450 734A1 (CYP734A1)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Functionality

Recombinant Arabidopsis thaliana Cytochrome P450 734A1 (CYP734A1), also known as BAS1, is a membrane-bound enzyme critical for brassinosteroid (BR) homeostasis. It catalyzes C-26 hydroxylation of bioactive brassinosteroids (e.g., castasterone [CS] and brassinolide [BL]), rendering them inactive ( ). This reaction regulates BR signaling pathways, influencing growth, photomorphogenesis, and stress responses.

Key Biochemical Characteristics

PropertyDescriptionSource
Enzyme ClassCytochrome P450 monooxygenase (heme-thiolate protein)
SubstratesCastasterone (CS), brassinolide (BL), and C-22 hydroxylated BR intermediates
Catalytic ReactionHydroxylation at C-26 position of BRs, producing inactive metabolites
CofactorHeme group (required for catalytic activity)
Subcellular LocalizationMembrane-associated (single-pass transmembrane protein)

CYP734A1 exhibits distinct substrate specificity compared to other BR-inactivating P450s like CYP72C1 (SOB7), which targets BR precursors rather than active hormones ( ).

Functional Roles in Brassinosteroid Regulation

CYP734A1 modulates BR signaling through two primary mechanisms:

  1. Direct Inactivation: Hydroxylation of CS and BL reduces their bioactivity, suppressing BR-responsive genes ( ).

  2. Biosynthesis Suppression: Degradation of BR precursors downstream of C-22 hydroxylation limits CS production ( ).

Genetic Interactions

Interaction PartnerRole in BR Signaling or PhotomorphogenesisSource
Photoreceptors (PHYB, CRY1)BAS1 expression in shoot apices is PHYB-dependent; light regulates BR catabolism
BES1/BZR1 Transcription FactorsCYP734A1 counteracts BR signaling by reducing BES1/BZR1 nuclear accumulation
CYP72C1 (SOB7)Synergistic/redundant roles in photomorphogenesis and flowering time control

In sdm2 mutants, CYP734A1 expression increases, indicating feedback regulation in BR-deficient environments ( ).

Applications in Research and Biotechnology

CYP734A1 is utilized in studies of BR metabolism and plant hormone crosstalk. Key applications include:

  • Hormone Biosensor Development: Yeast strains expressing CYP734A1 for BR detection ( ).

  • Metabolic Engineering: Overexpression in plants to study dwarf phenotypes or stress tolerance ( ).

  • Protein-Protein Interaction Studies: Co-expression with CPR2 (cytochrome P450 reductase) to reconstitute activity in vitro ( ).

Example Experimental Outcomes

Study TypeFindingSource
Heterologous ExpressionRecombinant CYP734A1 binds BL and CS with higher affinity than CYP72C1
Mutant Analysisbas1-2 mutants exhibit hypersensitivity to exogenous BRs and early flowering
Cross-Species StudiesRice CYP734A orthologs exhibit multifunctional BR catabolism (hydroxylation, oxidation)

Comparative Analysis with Related P450s

CYP734A1 differs biochemically and genetically from other BR-inactivating enzymes:

FeatureCYP734A1 (BAS1)CYP72C1 (SOB7)
Primary SubstratesCS, BL (active BRs)BR precursors (e.g., teasterone)
Catalytic ActivityC-26 hydroxylationUncharacterized (non-hydroxylation)
Photoreceptor InteractionPHYB-dependent expressionNo direct light regulation
Genetic RedundancySynergistic with CYP72C1Independent function

These distinctions underscore CYP734A1’s specialized role in fine-tuning BR levels during development ( ).

Challenges and Future Directions

  • Low Catalytic Efficiency: Recombinant CYP734A1 often requires co-expression with CPR2 for optimal activity ( ).

  • Structural Limitations: Lack of conserved residues in the active site complicates substrate docking predictions ( ).

  • Biotechnological Potential: Engineering CYP734A1 for industrial BR production or stress-resistant crops remains unexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP734A1; BAS1; At2g26710; F18A8.8; Cytochrome P450 734A1; Protein PHYB ACTIVATION-TAGGED SUPPRESSOR 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYP734A1
Target Protein Sequence
MEEESSSWFIPKVLVLSVILSLVIVKGMSLLWWRPRKIEEHFSKQGIRGPPYHFFIGNVK ELVGMMLKASSHPMPFSHNILPRVLSFYHHWRKIYGATFLVWFGPTFRLTVADPDLIREI FSKSEFYEKNEAHPLVKQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKLLVPVVLKSVT DMVDKWSDKLSENGEVEVDVYEWFQILTEDVISRTAFGSSYEDGRAVFRLQAQQMLLCAE AFQKVFIPGYRFFPTRGNLKSWKLDKEIRKSLLKLIERRRQNAIDGEGEECKEPAAKDLL GLMIQAKNVTVQDIVEECKSFFFAGKQTTSNLLTWTTILLSMHPEWQAKARDEVLRVCGS RDVPTKDHVVKLKTLSMILNESLRLYPPIVATIRRAKSDVKLGGYKIPCGTELLIPIIAV HHDQAIWGNDVNEFNPARFADGVPRAAKHPVGFIPFGLGVRTCIGQNLAILQAKLTLAVM IQRFTFHLAPTYQHAPTVLMLLYPQHGAPITFRRLTNHED
Uniprot No.

Target Background

Function
Cytochrome P450 734A1 (CYP734A1) is involved in brassinosteroid (BR) inactivation and homeostasis regulation. It inactivates the BRs castasterone and brassinolide via carbon 26 hydroxylation. CYP734A1 functions in conjunction with CYP72C1 to inactivate BRs and modulate photomorphogenesis.
Database Links

KEGG: ath:AT2G26710

STRING: 3702.AT2G26710.1

UniGene: At.43115

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CYP734A1 and what is its fundamental role in Arabidopsis thaliana?

CYP734A1 belongs to the diverse cytochrome P450 monooxygenase family, which comprises 244 genes and 28 pseudogenes in the Arabidopsis genome, making it one of the largest gene families in plants . Specifically, CYP734A1 functions as a brassinosteroid-inactivating enzyme critical for steroid-mediated signal transduction in Arabidopsis thaliana . Genetic analyses have demonstrated that this P450 modulates growth throughout plant development by regulating brassinosteroid hormone levels . Unlike some P450s that show functional redundancy, CYP734A1 has specialized functions that reflect the complexity of plant metabolism, particularly in hormone regulation pathways .

How does CYP734A1 biochemically interact with brassinosteroids?

CYP734A1 inactivates brassinosteroids specifically through C-26 hydroxylation . Substrate binding analyses have demonstrated that CYP734A1 effectively binds active brassinosteroids, including brassinolide and castasterone, as well as their upstream precursors . Unlike its counterpart CYP72C1, which primarily targets brassinosteroid precursors, CYP734A1 shows higher affinity for active brassinosteroid molecules . This biochemical specificity is evidenced in seedling growth assays, which have demonstrated that the genetic state of CYP734A1, but not CYP72C1, significantly affects responsiveness to high levels of exogenous brassinolide .

What experimental systems are most effective for studying recombinant CYP734A1?

When studying recombinant CYP734A1, heterologous expression systems are commonly employed, with yeast expression systems being particularly valuable . For functional expression of P450 enzymes including CYP734A1, an auxiliary reductase partner (CPR) is required - researchers often use ATR2 from Arabidopsis thaliana cloned into expression vectors such as YCplac33-TP with appropriate promoters and terminators (e.g., TDH3 promoter and PDC1 terminator) .

To assess enzyme activity, substrate feeding assays can be conducted where the recombinant enzyme is incubated with brassinosteroid substrates, followed by product analysis using techniques such as HPLC . When using heterologous expression systems, typical cultivation periods extend to approximately 4 days to ensure adequate protein expression and substrate conversion .

What structural considerations are important when studying the catalytic mechanism of CYP734A1?

Understanding the catalytic properties of CYP734A1 requires detailed structural analysis. Three-dimensional modeling is essential for examining substrate binding site structures and determining how they affect enzyme function . For CYP734A1, key structural elements to consider include:

  • The substrate binding pocket architecture, which determines brassinosteroid recognition

  • Conserved amino acid residues involved in substrate hydroxylation

  • Structural elements that differentiate it from related enzymes like CYP72C1

When conducting computational investigations of P450 catalytic pockets, several approaches have proven effective:

For the most accurate results, combining computational predictions with experimental validation via site-directed mutagenesis is recommended to confirm the role of specific amino acid residues in substrate binding and catalysis.

How do CYP734A1 and CYP72C1 differ in their functional roles despite both targeting brassinosteroids?

Although CYP734A1 and CYP72C1 both influence brassinosteroid signaling, they exhibit distinct biochemical functions that allow fine-tuning of different brassinosteroid hormone levels throughout plant growth and development . The key differences are summarized in the following table:

CharacteristicCYP734A1CYP72C1
Substrate preferenceActive brassinosteroids (brassinolide, castasterone) and precursorsPrimarily brassinosteroid precursors
Catalytic mechanismC-26 hydroxylationUnconfirmed, lacks conserved amino acids typically needed for hydroxylation
Effect on exogenous brassinolideGenetic state affects responsivenessGenetic state shows minimal effect on responsiveness
Active site structureContains conserved amino acids for substrate hydroxylationLacks several conserved amino acids typically needed for substrate hydroxylation

The distinct structural and functional properties of these enzymes suggest they evolved different regulatory roles in brassinosteroid metabolism, potentially allowing plants to modulate hormone levels at multiple points in the biosynthetic pathway .

What are the most effective approaches for optimizing recombinant CYP734A1 expression and activity?

Optimizing recombinant CYP734A1 expression requires attention to several critical factors:

  • Expression system selection: While yeast systems are commonly used, evaluating alternative hosts such as E. coli, insect cells, or plant-based expression systems may yield improved protein yields or activity .

  • Codon optimization: Adapting the CYP734A1 gene sequence to the codon usage bias of the expression host can significantly enhance protein production.

  • N-terminal modifications: As demonstrated with other P450s, truncation or modification of the N-terminal membrane-binding region can improve solubility and expression levels .

  • Reductase partner optimization: Co-expression with appropriate reductase partners is essential. For Arabidopsis P450s, ATR2 is commonly used, but optimizing the ratio of P450 to reductase can significantly improve catalytic efficiency .

  • Expression conditions: Systematic optimization of induction timing, temperature, and media composition can dramatically affect functional expression levels.

To assess optimization success, activity assays should be conducted using validated substrates (brassinolide and castasterone), with product formation quantified using HPLC or LC-MS/MS analysis .

What computational approaches can be employed to design improved variants of CYP734A1?

Recent advances in computational biology provide powerful tools for designing improved P450 variants. For CYP734A1, several approaches have shown promise:

  • Ancestral sequence reconstruction: This technique can identify evolutionary patterns and critical residues that define enzyme function .

  • Diffusion models: Building on recent successes with P450 enzymes, custom diffusion models (similar to P450Diffusion) can generate novel P450 sequences with desired properties . This approach has successfully produced artificial P450s with 1.3- to 3.5-fold increased catalytic efficiency compared to natural enzymes .

  • Virtual screening protocols: Multi-stage screening employing:

    • Computational metrics evaluation using tools like esm-1v, Alphafold2, and ProteinMPNN

    • Structure modeling and evaluation of substrate binding using docking tools

    • Molecular dynamics simulations to assess stability and substrate interactions

When designing artificial variants, special attention should be paid to maintaining proper folding and substrate binding stability, as molecular dynamics simulations have shown that reduced binding stability of substrates is often the primary reason for inactivity in designed enzymes .

What genomic and evolutionary considerations are important when studying CYP734A1?

Cytochrome P450s represent one of the most diverse enzyme families in plants, with significant diversification throughout evolution . When studying CYP734A1 from an evolutionary perspective, researchers should consider:

  • Gene duplication patterns: P450 gene families have expanded through duplication events, with mechanisms becoming better understood through genomic analysis .

  • Ortholog identification: Identifying CYP734A1 orthologs in other plant species can provide insights into functional conservation and diversification. Unlike some P450 families that appear as single copy genes in most dicots, brassinosteroid-metabolizing P450s often show greater divergence .

  • Transcriptional regulation: Analysis of co-expression data with other genes involved in brassinosteroid pathways can provide leads to functional characterization . Resources such as the CYPedia database (http://www-ibmp.u-strasbg.fr/∼CYPedia/) provide valuable information on expression patterns .

  • Pseudogene evaluation: The Arabidopsis genome contains 28 P450 pseudogenes, which might influence the evolution and regulation of functional P450s like CYP734A1 .

For comprehensive evolutionary analysis, researchers should utilize specialized P450 annotation resources such as those available at http://drnelson.uthsc.edu/CytochromeP450.html, which provide alignments and evolutionary relationships among P450 genes across diverse organisms .

What are the critical quality control steps for verifying recombinant CYP734A1 functionality?

When working with recombinant CYP734A1, implementing rigorous quality control measures is essential to ensure that experimental results accurately reflect the enzyme's natural activity:

  • Spectral characterization: Proper folding of CYP734A1 should be confirmed through characteristic absorbance at approximately 450 nm in the reduced CO-bound difference spectrum.

  • Substrate binding assays: Type I spectral shifts upon addition of brassinosteroid substrates should be measured to confirm substrate binding capability .

  • Activity validation: Enzymatic activity should be confirmed using established substrates (brassinolide and castasterone) with product formation quantified using HPLC or LC-MS/MS .

  • Kinetic parameter determination: Deriving Km and Vmax values for established substrates provides a quantitative benchmark for comparing different preparations or mutant variants.

  • Reductase coupling efficiency: As P450 activity depends on electron transfer from reductase partners, measuring the coupling efficiency is essential to distinguish between enzyme preparation quality and intrinsic catalytic efficiency .

How can researchers effectively analyze CYP734A1's role in brassinosteroid-regulated developmental processes?

To comprehensively analyze CYP734A1's role in plant development processes regulated by brassinosteroids, researchers should employ a multi-level experimental approach:

  • Genetic manipulation strategies:

    • CRISPR/Cas9-mediated gene editing to create precise mutations

    • Overexpression using tissue-specific or inducible promoters

    • RNAi or artificial microRNA for targeted knockdown

  • Phenotypic assays:

    • Seedling growth assays with and without exogenous brassinosteroids

    • Detailed morphometric analyses of plant organs

    • Time-course developmental studies across different growth stages

  • Metabolite profiling:

    • Quantitative analysis of brassinosteroid levels in different tissues

    • Measurement of brassinosteroid precursors and metabolites

    • Tracer studies using labeled brassinosteroids to track metabolism in vivo

  • Transcriptomic integration:

    • RNA-seq analysis to identify genes co-regulated with CYP734A1

    • Comparison with brassinosteroid-responsive gene sets

    • Integration with publicly available datasets from CYPedia and other resources

These approaches, when combined with detailed statistical analysis, can provide a comprehensive understanding of how CYP734A1 influences plant growth and development through brassinosteroid hormone regulation.

What are the emerging research frontiers for CYP734A1 studies?

The study of CYP734A1 continues to evolve with several promising research directions:

  • Structural biology advancements: Cryo-EM and improved crystallography techniques may soon provide higher-resolution structures of CYP734A1 bound to its substrates, offering unprecedented insights into catalytic mechanisms.

  • Systems biology integration: Positioning CYP734A1 within the broader network of brassinosteroid signaling through multi-omics approaches will enable more holistic understanding of hormone regulation.

  • Synthetic biology applications: The application of P450 design principles, like those demonstrated with P450Diffusion , may lead to engineered CYP734A1 variants with novel substrate specificities or improved catalytic properties.

  • Translational research: Understanding CYP734A1's role in growth regulation may inform agricultural applications for crop improvement through targeted modification of brassinosteroid pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.