Recombinant Arabidopsis thaliana Cytochrome P450 84A1 (CYP84A1)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome P450 monooxygenases (P450s) are a superfamily of heme-thiolate proteins broadly present in organisms, playing a key role in secondary metabolism and metabolic networks . In plants, P450s are crucial for the biosynthesis of diverse secondary compounds . Among these, recombinant Arabidopsis thaliana Cytochrome P450 84A1 (CYP84A1) is a specific P450 enzyme that functions in the phenylpropanoid pathway . The phenylpropanoid pathway is responsible for producing various metabolites, including lignin, which is essential for plant cell wall structure and integrity .

Discovery and Identification

CYP84A1 was first identified through the characterization of the fah1 mutant in Arabidopsis thaliana . This mutant exhibited a deficiency in accumulating sinapic acid-derived metabolites, which are components of the guaiacyl-syringyl lignin found in angiosperms . Map-based cloning and complementation of the mutant phenotype confirmed that the FAH1 locus encodes ferulate-5-hydroxylase (F5H), a cytochrome P450-dependent monooxygenase .

Function and Mechanism

CYP84A1, or F5H, catalyzes the 5-hydroxylation of ferulate, a crucial step in the biosynthesis of sinapic acid and, consequently, syringyl lignin . This hydroxylation is essential for the formation of the guaiacyl-syringyl lignin, which is typical of angiosperms .

Role in Lignin Biosynthesis

CYP84A1 plays a vital role in controlling the composition of the lignin polymer in Arabidopsis . Mutants lacking functional CYP84A1 exhibit altered lignin composition, highlighting the enzyme's importance in determining the structure and properties of lignin .

Subcellular Localization

Information regarding the specific subcellular localization of CYP84A1 was not found in the provided documents.

Expression Patterns

The temporal and tissue-specific expression of the CYP84A1 gene influences the lignin polymer's composition in Arabidopsis . Detailed expression studies provide insights into when and where CYP84A1 is active, contributing to the understanding of lignin biosynthesis regulation .

thaliana cDNA Library Screening

A study utilized an A. thaliana cDNA library to enhance the functional expression of P450s in Saccharomyces cerevisiae. This approach identified genes like AtGRP7, AtMSBP1, and AtCOL4 that significantly improved the activity of other P450 enzymes, demonstrating a novel strategy to enhance P450 activity for natural product production .

CYP84A1 and Paralogs

CYP84A4 is a paralog of CYP84A1, with CYP84A4 having neofunctionalized relative to its ancestral function . CYP84A4 3-hydroxylates... -coumaryl CoA via phenylalanine ammonia lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate: CoA ligase (4CL) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYP84A1; FAH1; At4g36220; F23E13.110; Cytochrome P450 84A1; Ferulate-5-hydroxylase; F5H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYP84A1
Target Protein Sequence
MESSISQTLSKLSDPTTSLVIVVSLFIFISFITRRRRPPYPPGPRGWPIIGNMLMMDQLT HRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDR ADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEVDKMVRSVSCNVGKPINVGEQI FALTRNITYRAAFGSACEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWIDPQGINKRLV KARNDLDGFIDDIIDEHMKKKENQNAVDDGDVVDTDMVDDLLAFYSEEAKLVSETADLQN SIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVE ESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKKSRVMINAFAIGRDPT SWTDPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHILHCFT WKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICAL
Uniprot No.

Target Background

Gene References Into Functions

Relevant Studies on Gene Function:

  1. Studies demonstrate that fah1 mutant Arabidopsis exhibits repressed synthesis of hydroxycinnamate esters and anthocyanins. (PMID: 26048881)
  2. Chloroplastic H2O2 likely activates FAH1 expression, inducing anthocyanin accumulation for photooxidative stress protection. (PMID: 24576765)
  3. UGT72E3/2 was combined with F5H (encoding ferulate 5-hydroxylase) and the transcriptional activator MYB58 within the sinapyl alcohol synthesis pathway. (PMID: 24667164)
  4. Research reports altered large-scale gene expression and glucoside analog accumulation in f5h and sct mutants of A. thaliana. (PMID: 19714359)
  5. In Camptotheca acuminata, F5H (a cytochrome P450-dependent monooxygenase) catalyzes ferulic acid, coniferaldehyde, and coniferyl alcohol hydroxylation, contributing to sinapic acid and syringyl lignin biosynthesis. Wounding stimulates its expression. (PMID: 16332414)
Database Links

KEGG: ath:AT4G36220

STRING: 3702.AT4G36220.1

UniGene: At.20230

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Cytochrome P450 84A1 (CYP84A1) and what is its primary function in Arabidopsis thaliana?

Cytochrome P450 84A1 (CYP84A1), also known as Ferulate-5-hydroxylase (F5H), is a membrane-bound enzyme that plays a crucial role in lignin biosynthesis in Arabidopsis thaliana. This enzyme specifically hydroxylates coniferyl alcohol/aldehyde at its benzene ring 5-position, which is essential for S-lignin monomer formation in angiosperms . CYP84A1 is encoded by the FAH1 gene (At4g36220) and is part of the large cytochrome P450 superfamily in plants, which includes 244 genes and 28 pseudogenes in the Arabidopsis genome . Beyond lignin biosynthesis, CYP84A1 is also involved in the synthesis of 5-hydroxylated derivatives such as sinapoyl esters found in the Brassicaceae family .

How does CYP84A1 fit into the broader cytochrome P450 classification system in plants?

CYP84A1 belongs to the cytochrome P450 superfamily, which is one of the largest gene families in plants. In Arabidopsis, P450s are categorized into A-type and non-A-type clades based on their phylogenetic relationships. While the A-type P450s (primarily CYP71 clan) were initially thought to be involved mainly in secondary metabolism, and non-A-types in essential "housekeeping" functions, this distinction has become less clear with further research . CYP84A1, despite its role in secondary metabolism (lignin biosynthesis), does not belong to the CYP71 clan, highlighting that functional roles cross phylogenetic boundaries in the P450 superfamily. The P450 classification system is continuously refined as more biochemical and genetic knowledge is gained from Arabidopsis and other plant species .

What are the most effective heterologous expression systems for producing recombinant CYP84A1?

Several heterologous expression systems have been successfully used for producing recombinant plant P450s, including CYP84A1:

  • Insect Cell/Baculovirus Expression System: This system has been effectively used for expressing Arabidopsis P450 reductases (AR1 and AR2), which are electron transfer partners for P450s like CYP84A1 . The baculovirus expression system allows for proper folding and post-translational modifications of membrane proteins.

  • Yeast Expression Systems: Saccharomyces cerevisiae strains engineered for cytochrome P450 expression (such as WAT11) have been successfully used for expressing plant P450s. For example, CYP77A4 from Arabidopsis was functionally expressed in the WAT11 yeast strain .

  • Plant Expression Systems: For in planta studies, Arabidopsis itself can be used as an expression system, often using the CYP73A5 promoter to drive the expression of CYP84A1 in vascular tissues where lignification occurs .

The choice of expression system depends on the research goals, with insect cell and yeast systems being preferable for biochemical characterization, while plant systems are valuable for in vivo functional studies.

What modifications to the native CYP84A1 sequence can improve recombinant protein yield and stability?

Several modifications can enhance recombinant CYP84A1 expression and stability:

  • N-terminal Modifications: Truncation or modification of the hydrophobic N-terminal membrane-anchoring region can improve solubility without affecting catalytic activity. This approach was successfully used with Arabidopsis P450 reductases .

  • Codon Optimization: Adapting the CYP84A1 coding sequence to the codon usage bias of the host expression system can significantly improve translation efficiency and protein yield.

  • Addition of Affinity Tags: Incorporating purification tags (His-tag, GST, etc.) facilitates purification while potentially enhancing stability. The tag placement (N- or C-terminal) should be optimized to avoid interfering with enzyme activity.

  • Co-expression with Chaperones: Co-expressing molecular chaperones can improve proper folding and reduce aggregation of recombinant P450s.

  • Glycerol Addition: Including glycerol (commonly 50%) in storage buffers helps maintain protein stability and activity during storage, as demonstrated for recombinant Arabidopsis proteins .

How can I establish a reliable in vitro assay system for measuring CYP84A1 activity?

A reliable in vitro assay system for CYP84A1 should include:

  • Reconstitution Components:

    • Purified recombinant CYP84A1

    • NADPH-cytochrome P450 reductase (preferably Arabidopsis ATR1 or ATR2)

    • NADPH regenerating system (NADPH, glucose-6-phosphate, glucose-6-phosphate dehydrogenase)

    • Appropriate substrates (coniferyl alcohol/aldehyde)

    • Suitable buffer system maintaining pH ~7.4

  • Assay Conditions:

    • Temperature: 25-30°C (optimal for plant enzymes)

    • Reaction time: Typically 15-60 minutes

    • Substrate concentration range: 10-500 μM

  • Activity Detection Methods:

    • HPLC or LC-MS analysis to detect 5-hydroxylated products

    • Spectrophotometric monitoring of NADPH oxidation at 340 nm

    • Radio-labeled substrate tracking (if available)

  • Controls:

    • No-enzyme control

    • Heat-inactivated enzyme control

    • Known inhibitor control (e.g., general P450 inhibitors like ketoconazole)

Based on research with similar P450s, the reconstitution system can achieve activities around 70 nmol min⁻¹ nmol⁻¹ P450 when optimized .

What are the key kinetic parameters of CYP84A1 and how do they compare to other plant P450s?

While specific kinetic parameters for CYP84A1 are not directly provided in the search results, comparative data can be gleaned from related P450 systems:

ParameterCYP84A1 (estimated)CYP73A5 (Cinnamate 4-hydroxylase)CYP79A1 (S. bicolor)
KmNot directly reportedSimilar to CYP79A1 parameters0.21 mM
kcatNot directly reported~70 nmol min⁻¹ nmol⁻¹ P450200 min⁻¹
Substrate specificitySpecific for coniferyl alcohol/aldehydeSpecific for cinnamic acidSpecific for tyrosine
Electron donor preferenceLikely both ATR1 and ATR2Both ATR1 and ATR2 equally effectiveNot specified

CYP84A1 and other plant P450s typically demonstrate relatively high substrate specificity compared to mammalian P450s. Despite the large number of P450s in plants (244 in Arabidopsis), functional redundancy is limited , suggesting that CYP84A1 has evolved specific kinetic properties to match its unique role in lignin biosynthesis.

How do the different isoforms of NADPH-cytochrome P450 reductase (ATR1/AR1 and ATR2/AR2) affect CYP84A1 activity?

Arabidopsis thaliana has two distinct NADPH-cytochrome P450 reductase isoforms encoded by separate genes (AR1/ATR1 and AR2/ATR2) . Their interaction with CYP84A1 has several important characteristics:

While both reductases can support CYP84A1 activity in vitro, ATR2 appears to be the physiologically relevant electron donor in lignifying tissues where CYP84A1 functions .

What role does cytochrome b5 play in modulating CYP84A1 activity and how does this vary across different plant tissues?

Cytochrome b5 (CB5) plays a complex and tissue-specific role in modulating P450 activities in Arabidopsis:

  • Multiple CB5 Isoforms with Distinct Functions:

    • Arabidopsis contains five CB5 members (AtCB5A to AtCB5E) and one CB5-like protein (CB5LP) .

    • These isoforms show distinct tissue-specific expression patterns and non-redundant functions.

    • AtCB5D plays a dominant role in supporting F5H1 (CYP84A1) activity specifically for S-lignin formation and sinapoyl ester biosynthesis .

  • Electron Transfer Pathway Specificity:

    • AtCB5D can interact with both NADH-dependent cytochrome b5 reductase (CBR1) and NADPH-dependent cytochrome P450 reductase (ATR) .

    • This allows for flexible electron sourcing from either NADH or NADPH, potentially optimizing CYP84A1 activity under different cellular redox conditions.

  • Tissue-Specific Effects:

    • Disruption of AtCB5D alone resulted in ~70% reduction in leaf sinapoyl esters and 69% decrease in stem S-lignin subunits .

    • Other CB5 isoforms could not complement the cb5d-1 mutation when expressed under the C4H promoter, demonstrating the unique role of AtCB5D in 5-hydroxylation reactions .

  • Quantitative Impact:

    CB5 MutantSinapoyl Esters ReductionS-Lignin ReductionG-Lignin Effect
    cb5d-1~70%69%Slight increase
    cb5a-1No significant effectNo significant effectNo significant effect
    cb5b-1No significant effectNo significant effectNo significant effect
    cb5c-1No significant effectNo significant effectNo significant effect
    cb5e-1No significant effectNo significant effectNo significant effect
    bc (double)No significant effectNo significant effectNo significant effect
    de (double)Similar to cb5d-1Similar to cb5d-1Similar to cb5d-1
    bcde (quad)Similar to cb5d-1Similar to cb5d-1Similar to cb5d-1

This tissue-specific recruitment of electron transfer chains for CYP84A1 provides a sophisticated regulatory mechanism for balancing the synthesis of different phenylpropanoid derivatives according to developmental and environmental cues .

How can CYP84A1 be used to modify lignin composition in transgenic plants?

CYP84A1 (F5H) is a key control point for modifying lignin composition in transgenic plants, particularly for altering the syringyl/guaiacyl (S/G) ratio:

  • Overexpression Approaches:

    • Expressing CYP84A1 under control of strong vascular-specific promoters like the CYP73A5 promoter can drive increased S-lignin production in target tissues .

    • This approach has been used to increase the S-lignin content in plants, which can improve pulping efficiency and reduce the need for chemical treatments in paper production.

  • Promoter Selection:

    • The choice of promoter is critical for successful lignin modification. Tissue-specific promoters from genes involved in lignification (such as C4H) are particularly effective for targeting CYP84A1 expression to vascular tissues .

    • Using these specific promoters minimizes potential developmental abnormalities that might arise from constitutive expression.

  • Coordinated Expression with Electron Transfer Partners:

    • For optimal CYP84A1 function in transgenic plants, co-expression with appropriate electron transfer partners is crucial.

    • Since AtCB5D plays a dominant role in supporting CYP84A1 activity for S-lignin formation , coordinated expression of both genes may enhance the effectiveness of lignin modification strategies.

  • Potential Trade-offs:

    • Modifying lignin composition through CYP84A1 manipulation may affect plant resistance to pathogens and abiotic stresses, as phenylpropanoid-derived compounds play important roles in plant defense.

    • Changes in lignin composition may also affect mechanical properties of plant tissues, potentially impacting agronomic traits.

What strategies can be used to study CYP84A1 localization and dynamics in living plant cells?

Several contemporary strategies can be employed to study CYP84A1 localization and dynamics in living plant cells:

  • Fluorescent Protein Fusions:

    • Creating CYP84A1-GFP (or other fluorescent protein) fusions allows visualization of the enzyme in living cells.

    • Care must be taken in the design of fusion proteins to ensure the N-terminal membrane anchor of CYP84A1 remains functional.

    • For dual-color studies, CYP84A1 can be tagged with one fluorescent protein while potential interacting partners (like ATR2 or AtCB5D) are tagged with spectrally distinct fluorophores.

  • Advanced Microscopy Techniques:

    • Confocal microscopy allows 3D visualization of CYP84A1 localization.

    • Super-resolution microscopy techniques (STED, PALM, STORM) can resolve CYP84A1 distribution at the nanoscale.

    • FRET (Förster Resonance Energy Transfer) can be used to study interactions between CYP84A1 and its electron transfer partners in vivo.

  • Microgravity Studies:

    • The International Space Station provides a unique environment to study fundamental plant processes without the masking effect of gravity .

    • Similar to the CARA and APEX03-2 experiments that studied auxin distribution in Arabidopsis roots , microgravity experiments could reveal gravity-independent aspects of CYP84A1 localization and lignification patterns.

  • Inducible Expression Systems:

    • Using inducible promoters to control CYP84A1-FP expression allows temporal control over visualization experiments.

    • This approach is particularly valuable for studying dynamic relocalization in response to developmental cues or stresses.

  • Cryo-Electron Microscopy:

    • For high-resolution structural studies in a near-native state, cryo-EM of CYP84A1 in membrane fragments can provide insights into its organization and interactions with partner proteins.

These approaches, particularly when combined, can provide comprehensive information about the spatiotemporal dynamics of CYP84A1 in relation to lignin biosynthesis and other cellular processes.

How do evolutionary relationships between CYP84A1 and other P450s inform our understanding of specialized metabolism in plants?

The evolutionary relationships between CYP84A1 and other P450s provide key insights into specialized metabolism in plants:

  • Gene Duplication and Neofunctionalization:

    • CYP84A1 appears to have arisen through gene duplication events, a common mechanism in P450 evolution. For example, CYP84A4, an Arabidopsis-specific paralog of CYP84A1, has neofunctionalized to catalyze the biosynthesis of arabidopyrones, a class of substituted α-pyrone metabolites .

    • This demonstrates how new metabolic pathways can evolve through duplication and divergence of P450 genes.

  • Conservation vs. Innovation:

    • While the general reaction mechanism (hydroxylation of aromatic rings) is conserved, substrate specificity has diversified greatly among plant P450s.

    • The P450 families involved in specialized metabolism often show rapid evolutionary rates compared to those involved in primary metabolism.

  • Taxonomic Distribution:

    • P450-mediated pathways often correlate with taxonomic boundaries. For example, the 5-hydroxylated derivatives (sinapoyl esters) produced via CYP84A1 activity are predominantly found in the Brassicaceae family .

    • This pattern suggests that P450-driven specialized metabolism contributes to adaptive evolution and speciation.

  • Recruitment of Ancient Mechanisms:

    • The arabidopyrone biosynthesis pathway involves CYP84A4 (derived from CYP84A1) working with AtLigB, an extradiol ring-cleavage dioxygenase. While CYP84A4 is Arabidopsis-specific, AtLigB homologs are widespread among land plants and many bacteria .

    • This exemplifies how novel pathways often evolve by recruiting enzymes with ancient origins into new metabolic contexts.

  • Convergent Evolution:

    • In some cases, similar metabolic functions have evolved independently in different P450 clades. For example, P450s in the biosynthesis of gibberellins show cases of convergent evolution between plant CYP701 and fungal CYP68 families .

Understanding these evolutionary patterns provides a framework for predicting and discovering new P450-mediated pathways in plants, potentially leading to novel bioactive compounds and metabolic engineering strategies.

What are the structural determinants of substrate specificity in CYP84A1 and how can this inform protein engineering efforts?

The structural determinants of CYP84A1 substrate specificity remain incompletely characterized, but several approaches can be used to elucidate them and guide protein engineering efforts:

  • Key Structural Regions for Substrate Specificity:

    • The substrate recognition sites (SRS1-6) are likely critical for determining CYP84A1's specificity for coniferyl alcohol/aldehyde.

    • The active site cavity size and shape must accommodate the phenylpropanoid substrate while positioning the 5-position of the aromatic ring near the heme iron.

    • The F-G loop region often contributes to substrate access channels in P450s and may be important for CYP84A1 function.

  • Comparative Analysis with Related P450s:

    • CYP84A1 and its paralog CYP84A4 have distinct substrate preferences despite high sequence similarity. CYP84A4 is involved in arabidopyrone biosynthesis rather than lignin biosynthesis .

    • Detailed sequence comparison between these paralogs, focusing on divergent residues in SRS regions, can identify potential specificity determinants.

  • Homology Modeling and Molecular Dynamics:

    • In the absence of a crystal structure, homology models based on structurally characterized plant P450s can provide insights into substrate binding.

    • Molecular dynamics simulations can reveal conformational changes associated with substrate binding and catalysis.

  • Protein Engineering Strategies:

    • Rational Design: Targeted mutations of specific residues in SRS regions based on sequence comparisons and modeling.

    • Domain Swapping: Exchanging SRS regions between CYP84A1 and related P450s (like CYP84A4) to alter substrate specificity.

    • Directed Evolution: Creating libraries of CYP84A1 variants through random or semi-random mutagenesis, followed by screening for altered substrate specificity.

  • Interaction with Redox Partners:

    • Engineering the interaction interface between CYP84A1 and its electron transfer partners (ATR2, AtCB5D) could enhance catalytic efficiency.

    • The N-terminal region and proximal surface of CYP84A1 likely contain residues critical for these protein-protein interactions.

Understanding these structural features would enable several biotechnological applications:

  • Creation of CYP84A1 variants with altered regioselectivity for hydroxylation

  • Engineering variants with improved catalytic efficiency

  • Developing CYP84A1-based biosensors for phenylpropanoid intermediates

  • Rational design of CYP84A1 inhibitors for research or agricultural applications

How does spaceflight and microgravity affect CYP84A1 expression and lignin biosynthesis in Arabidopsis?

While the search results don't directly address CYP84A1 expression under spaceflight conditions, we can draw insights from related research on plant responses to microgravity:

  • Transcriptome Remodeling in Spaceflight:

    • Transcription profiling by array of Arabidopsis whole plants and discrete root, hypocotyl, and shoot responses to spaceflight has been conducted , which might include data on CYP84A1 expression.

    • Plants exhibit organ-specific remodeling of their transcriptome in response to spaceflight , suggesting that lignification patterns might be altered in a tissue-specific manner.

  • Potential Mechanisms of CYP84A1 Regulation in Microgravity:

    • Altered mechanical stress in microgravity could impact lignification patterns, potentially through changes in CYP84A1 expression or activity.

    • Changes in hormone signaling (particularly auxin distribution) observed in spaceflight might indirectly affect phenylpropanoid metabolism and CYP84A1 function.

  • Research Approaches:

    • Transcriptomics: Analysis of CYP84A1 expression in spaceflight samples compared to ground controls.

    • Metabolomics: Profiling lignin composition and sinapoyl esters in plants grown in microgravity.

    • Imaging: Using reporter gene constructs (CYP84A1 promoter driving GFP) to visualize expression patterns in spaceflight.

    • Hardware Requirements: Similar to the CARA and APEX03-2 experiments , specialized growth hardware and imaging capabilities would be needed on the ISS.

  • Potential Significance:

    • Understanding how gravitational forces influence lignification could provide insights into fundamental mechanisms of plant development.

    • This knowledge could inform strategies for growing plants in space habitats where mechanical properties of stems might be crucial for successful cultivation.

    • Altered lignin composition in microgravity might affect nutritional or processing qualities of space-grown plants.

Future spaceflight experiments specifically targeting CYP84A1 expression and lignin biosynthesis would be valuable for understanding plant adaptation to microgravity environments and could potentially lead to novel biotechnological applications.

What are the best approaches for measuring changes in lignin composition resulting from CYP84A1 manipulation?

Several complementary analytical approaches can be used to comprehensively assess lignin changes resulting from CYP84A1 manipulation:

  • Thioacidolysis:

    • This degradative method specifically cleaves β-O-4 linkages in lignin, releasing monomers that can be analyzed by GC-MS.

    • Provides quantitative data on H:G:S ratios, making it particularly useful for assessing changes in S-lignin resulting from CYP84A1 manipulation.

    • Methodology involves treating isolated cell walls with boron trifluoride etherate and ethanethiol, followed by extraction and derivatization of released monomers.

  • 2D-NMR Spectroscopy:

    • Provides comprehensive structural information about lignin polymers without degradation.

    • Heteronuclear Single Quantum Coherence (HSQC) NMR can reveal changes in lignin linkage types and monomer composition.

    • Requires specialized equipment but gives detailed information about lignin structural changes.

  • Pyrolysis-GC/MS:

    • Provides information about lignin composition based on characteristic pyrolysis products.

    • Relatively small sample size requirements make this suitable for high-throughput screening.

    • Data analysis can be complex but provides rich information about lignin structural features.

  • Histochemical Staining:

    • Mäule staining specifically reacts with syringyl units, producing a red-purple color.

    • Phloroglucinol-HCl (Wiesner stain) primarily detects G-units, producing a red-pink color.

    • These stains allow visualization of lignin distribution and composition changes in tissue sections.

  • UV Microspectrophotometry:

    • Allows in situ analysis of lignin in cell walls based on characteristic UV absorption.

    • Can provide spatial information about changes in lignin composition across different cell types.

When studying CYP84A1 manipulation effects, combining these methods provides a comprehensive assessment of lignin changes, from polymer structure to tissue-specific distribution.

How can systems biology approaches be applied to understand the impact of CYP84A1 modification on the whole plant metabolome?

Systems biology approaches offer powerful tools for understanding the holistic impact of CYP84A1 modification:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.