Recombinant Arabidopsis thaliana Dehydrodolichyl diphosphate synthase 1 (DPS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DPS; ACPT; At2g23410; F26B6.6; Dehydrodolichyl diphosphate synthase 1; Dedol-PP synthase 1; Ditrans,polycis-polyprenyl diphosphate synthase; (2E,6E-farnesyl diphosphate specific 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
DPS
Target Protein Sequence
MLSLLSSDSSLLSLLFLFLIPCLFITSYIGFPVFLLKLIGLIKIKAARDNEKRDEGTYVV REDGLQRELMPRHVAFILDGNRRWAKRAGLTTSQGHEAGAKRLIDIAELCFELGVHTVSA FAFSTENWGRDKIEIDNLMSLIQHYRNKSNIKFFHRSEVRVSVIGNKTKIPESLLKEIHE IEEATKGYKNKHLIMAVDYSGKFDIMHACKSLVKKSEKGLIREEDVDEALIERELLTNCS DFPSPDLMIRTSGEQRISNFFLWQLAYSELFFSPVFWPDFDKDKLLEALASYQRRERRFG CRV
Uniprot No.

Target Background

Function
This recombinant *Arabidopsis thaliana* Dehydrodolichyl diphosphate synthase 1 (DPS) catalyzes the elongation of cis-prenyl chains to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid essential for the biosynthesis of various glycoproteins.
Database Links

KEGG: ath:AT2G23410

STRING: 3702.AT2G23410.1

UniGene: At.10003

Protein Families
UPP synthase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in low levels in the whole plant. Preferentially expressed in roots.

Q&A

What is the biochemical function of Dehydrodolichyl diphosphate synthase in Arabidopsis thaliana?

Dehydrodolichyl diphosphate synthase (dedol-PP synthase) functions as a cis-prenyltransferase that catalyzes the synthesis of dedol-PP, which serves as a long-chain polyprenyl diphosphate precursor for dolichyl phosphate synthesis. The enzyme specifically catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins . As part of the isoprenoid biosynthetic pathway, DPS plays a critical role in producing compounds essential for plant growth and development. The enzyme utilizes isopentenyl diphosphate (IPP) as a substrate for condensation reactions with allylic prenyl diphosphates, resulting in the elongation of the isoprenoid chain .

A typical reaction catalyzed by DPS involves the sequential addition of IPP units to farnesyl diphosphate (FPP) or geranylgeranyl diphosphate (GGPP), producing increasingly longer polyisoprenoid chains. This process is essential for generating the dolichol backbone, which serves as a crucial carrier for oligosaccharides in the protein N-glycosylation pathway.

How is the DPS gene expressed in different tissues of Arabidopsis thaliana?

The expression pattern of Arabidopsis thaliana dedol-PP synthase exhibits remarkable tissue specificity. Research has shown that DPS mRNA is detected at high levels in roots but is barely detectable in flowers, leaves, stems, and suspension-cultured cells . This differential expression pattern suggests a specialized role for this enzyme in root tissue, possibly related to specific glycosylation requirements or developmental processes particular to root function.

The tissue-specific expression profile indicates that dolichol biosynthesis may be regulated differently across plant tissues, with roots potentially having higher demands for dolichol-dependent protein glycosylation. This expression pattern also suggests that alternative pathways or enzymes might fulfill similar functions in aerial tissues where DPS expression is minimal.

How was the Arabidopsis thaliana DPS gene identified and validated?

The identification and validation of the Arabidopsis thaliana DPS gene involved multiple complementary approaches. Researchers successfully cloned a cDNA from Arabidopsis encoding dedol-PP synthase and confirmed its identity through functional complementation experiments . The validation process included transforming a yeast mutant strain defective in dedol-PP synthase activity with the cloned Arabidopsis cDNA. The successful complementation was evidenced by the restoration of growth under restrictive conditions and the detection of high levels of dedol-PP synthase activity in the transformed yeast mutant .

This functional complementation approach provided strong evidence for the identity of the cloned enzyme as a genuine dedol-PP synthase. The experimental validation demonstrated that the plant enzyme could function in the yeast cellular context, suggesting conservation of fundamental enzymatic mechanisms across different eukaryotic kingdoms.

Further characterization likely involved:

  • Sequence analysis to identify conserved domains typical of cis-prenyltransferases

  • Biochemical assays to confirm the enzyme's substrate specificity and product profile

  • Expression analysis to determine tissue-specific patterns

What is the relationship between the identified CPT3 gene and DPS in Arabidopsis?

Recent studies have identified AT2G17570, encoding a cis-prenyltransferase (CPT3), as a gene implicated in the accumulation of major dolichols in Arabidopsis . CPT3 appears to function as a dehydrodolichyl diphosphate synthase, representing a long-sought component in the dolichol biosynthetic pathway. Research combining QTL and GWAS approaches successfully identified CPT3 among several candidate genes involved in the accumulation of dolichols in Arabidopsis .

The relationship between CPT3 and previously described DPS activities lies in their functional roles in dolichol biosynthesis. Experimental confirmation has validated CPT3's role in dolichol accumulation, suggesting it is a key enzyme in the synthesis pathway. This identification filled a significant gap in understanding the enzymatic machinery responsible for dolichol production in plants.

Additionally, studies have identified another gene, AT1G52460 encoding an α/β-hydrolase, that works in conjunction with CPT3 to determine dolichol accumulation in Arabidopsis . This finding suggests that dolichol biosynthesis involves a coordinated action of multiple enzymes beyond the core prenyltransferase activity.

What structural features characterize the Arabidopsis DPS enzyme?

The Arabidopsis DPS enzyme shares several structural features with other cis-prenyltransferases that define its function and specificity:

  • Conserved Catalytic Domains: The enzyme contains conserved aspartate-rich motifs (such as DDxxD) that coordinate magnesium ions essential for binding the diphosphate moieties of substrates .

  • Hydrophobic Binding Pocket: A substantial hydrophobic cavity accommodates the growing isoprenoid chain during synthesis, with the size and shape of this pocket influencing the final product length.

  • Active Site Architecture: Specific residues line the active site to facilitate the sequential addition of IPP units to the growing prenyl chain, determining substrate specificity and product chain length.

  • Chain Length Determination Mechanism: "Floor" residues at the bottom of the active site cavity and "gatekeeper" residues at the entrance control the depth of the cavity and thereby influence the final product chain length.

While a crystal structure for Arabidopsis DPS has not been explicitly described in the provided literature, structural features have likely been inferred from sequence homology with related enzymes and through site-directed mutagenesis studies. Computational modeling approaches have been valuable in predicting structural features in the absence of crystallographic data.

What expression systems are optimal for producing recombinant Arabidopsis DPS?

For optimal heterologous expression of Arabidopsis DPS, several expression systems and conditions have been established:

Expression SystemAdvantagesOptimization Strategies
E. coli BL21(DE3)High expression levels, ease of culture, rapid growthLow temperature expression (16-18°C), reduced IPTG concentration (0.1-0.5 mM)
Yeast (S. cerevisiae)Eukaryotic post-translational processing, suitable for complementation studiesSelection of appropriate promoters, optimization of codon usage
Insect cellsEnhanced protein folding, post-translational modificationsOptimization of multiplicity of infection, harvest timing
Plant expression systemsNative cellular environment, proper targetingSelection of appropriate plant tissues, transient vs. stable expression

For E. coli expression systems, the following parameters have proven effective:

  • Growth temperature: Reduce to 16-18°C after induction to minimize inclusion body formation

  • Induction timing: At OD₆₀₀ of 0.6-0.8

  • Media: Rich media (2xYT or TB) supplemented with 5-10 mM MgCl₂

  • Solubility enhancement: Co-expression with chaperones or fusion with solubility tags (SUMO, MBP)

The yeast complementation system has been successfully used for functional validation of Arabidopsis DPS, demonstrating that the plant enzyme can be properly expressed and function in this heterologous system .

How can enzymatic activity of recombinant DPS be accurately measured in vitro?

Several complementary methods have been developed for measuring the enzymatic activity of recombinant DPS in vitro:

  • Radioisotope-Based Assays:

    • Incubation of enzyme with [¹⁴C]-IPP and appropriate allylic substrate (FPP/GGPP)

    • Extraction of products with organic solvents

    • Quantification via liquid scintillation counting

  • HPLC-Based Methods:

    • Reaction of enzyme with unlabeled substrates

    • Dephosphorylation of products if necessary

    • Separation and quantification by reverse-phase HPLC

    • Detection via UV absorption (210 nm)

  • Coupled Enzyme Assays:

    • Measurement of pyrophosphate release during chain elongation

    • Conversion of pyrophosphate to phosphate using pyrophosphatase

    • Colorimetric detection of phosphate

Standard reaction conditions typically include:

  • Buffer: 50 mM HEPES or Tris-HCl (pH 7.5)

  • Salt: 100 mM NaCl

  • Divalent cation: 5-10 mM MgCl₂ (essential cofactor)

  • Reducing agent: 1 mM DTT

  • Substrates: 50-100 μM allylic substrate (FPP/GGPP) and 50-400 μM IPP

  • Temperature: 30-37°C

  • Incubation time: 30-60 minutes

Product analysis can be further enhanced using mass spectrometry to determine the exact chain length and structure of the synthesized polyisoprenoids.

What approaches can be used to study the subcellular localization of DPS in Arabidopsis cells?

Understanding the subcellular localization of DPS requires multiple complementary approaches:

  • Fluorescent Protein Fusion Studies:

    • Construction of N- and C-terminal GFP/YFP fusions with DPS

    • Transient expression in Arabidopsis protoplasts or stable transformation

    • Visualization using confocal microscopy

    • Co-localization with organelle-specific markers (especially ER markers, as dolichol biosynthesis typically occurs in association with the ER)

  • Immunolocalization:

    • Development of specific antibodies against Arabidopsis DPS

    • Immunofluorescence microscopy on fixed tissues

    • Immunogold labeling for electron microscopy to achieve higher resolution

  • Subcellular Fractionation:

    • Differential centrifugation to separate major cellular compartments

    • Density gradient centrifugation for finer separation

    • Western blot analysis of fractions using anti-DPS antibodies

    • Measurement of DPS activity in isolated fractions

  • Bioinformatic Prediction:

    • Analysis of protein sequence for targeting signals using algorithms like TargetP, PSORT

    • Identification of transmembrane domains or ER retention signals

    • Comparative analysis with localization of homologous enzymes

Since dolichol synthesis is typically associated with the endoplasmic reticulum in eukaryotes, confirmation of ER localization would be consistent with the enzyme's function in dolichol biosynthesis for protein glycosylation.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of DPS?

Site-directed mutagenesis provides valuable insights into the catalytic mechanism of DPS through systematic modification of key residues:

  • Target Residue Selection:

    • Conserved aspartate-rich motifs (DDxxD) that coordinate magnesium ions for diphosphate binding

    • Aromatic residues potentially involved in stabilizing carbocation intermediates

    • Residues lining the hydrophobic cavity that may determine product chain length

    • Charged residues potentially involved in substrate binding or catalysis

  • Mutagenesis Strategy:

    • Alanine scanning: Replacing target residues with alanine to remove side chain functionality

    • Conservative substitutions: Maintaining charge or polarity while altering size

    • Non-conservative substitutions: Testing specific mechanistic hypotheses

  • Functional Analysis of Mutants:

Analysis MethodParameters MeasuredInformation Gained
Steady-state kineticsKm, kcat, kcat/KmSubstrate binding affinity, catalytic efficiency
Product analysisChain length distributionEffects on product specificity
Binding studiesKd, thermodynamic parametersDirect substrate interactions
Structural analysisSecondary/tertiary structure changesEffects on protein folding
  • Mechanistic Interpretation:

    • Correlation of kinetic effects with structural positions

    • Development of a comprehensive catalytic model

    • Comparison with mechanisms of related enzymes

This approach has been successfully applied to related prenyl transferases, revealing the roles of specific residues in substrate binding, catalysis, and product chain length determination.

How does DPS activity affect dolichol levels and protein glycosylation in plants?

DPS activity directly impacts dolichol levels, which in turn affects protein glycosylation in plants through several mechanisms:

Research has demonstrated that genes implicated in dolichol accumulation, including the cis-prenyltransferase CPT3 and an α/β-hydrolase encoded by AT1G52460, are determinants of dolichol levels in Arabidopsis . Experimental confirmation of their roles suggests a coordinated enzymatic system regulating dolichol availability for glycosylation processes.

What is the impact of environmental stresses on DPS expression and dolichol biosynthesis?

Environmental stresses significantly influence DPS expression and dolichol biosynthesis in plants:

  • Drought Stress Response:

    • Drought stress alters the expression of many genes involved in isoprenoid biosynthesis

    • During drought, plants undergo a reallocation of metabolic resources that may affect dolichol biosynthesis

    • When drought is combined with heat stress, a unique transcriptional response occurs that differs from either stress alone

  • Temperature Stress Effects:

    • Heat stress induces a complex cellular response involving chaperones and stress-responsive proteins

    • Many of these proteins require proper glycosylation for function, potentially increasing demand for dolichol biosynthesis

    • The combined effect of drought and heat stress results in a distinct pattern of gene expression that differs from the individual stresses

  • Regulatory Mechanisms:

    • Transcriptional regulation through stress-responsive promoter elements affects DPS expression

    • Post-translational modifications may alter enzyme activity under stress conditions

    • Changes in substrate availability due to altered metabolic flux through isoprenoid pathways

  • Metabolic Adjustments:

    • Stress conditions cause reallocation of isoprenoid precursors between different biosynthetic pathways

    • Plants subjected to combined stresses show unique metabolic signatures, including altered accumulation of sugars but not proline

    • The balance between MVA and MEP pathway contributions to isoprenoid biosynthesis may shift under stress

Understanding these stress responses is crucial for engineering plants with enhanced stress tolerance while maintaining essential glycosylation functions. The distinct responses to combined stresses compared to individual stresses highlight the complexity of plant stress adaptation mechanisms.

How does DPS activity vary among different Arabidopsis accessions and what factors contribute to this variation?

Natural variation in DPS activity and dolichol accumulation among Arabidopsis accessions provides insights into the genetic and environmental factors controlling this pathway:

  • Genetic Determinants:

    • Studies analyzing natural variation in dolichol accumulation across more than 120 Arabidopsis accessions have identified several candidate genes involved in this process

    • Combining QTL and GWAS approaches has revealed genes implicated in the accumulation of dolichols, including CPT3 (AT2G17570) and an α/β-hydrolase (AT1G52460)

    • These genetic factors likely contribute to the observed variation in dolichol profiles between accessions

  • Variation Patterns:

    • Different Arabidopsis accessions show distinct patterns of accumulation for dolichols and other isoprenoids

    • This variation may reflect adaptation to different environmental conditions or developmental strategies

    • The diversity in dolichol accumulation provides a valuable resource for understanding pathway regulation

  • Contributing Factors:

    • Sequence polymorphisms in the coding regions of biosynthetic enzymes

    • Variations in promoter regions affecting gene expression levels

    • Differences in post-translational regulation mechanisms

    • Interaction with other metabolic pathways that may be differentially regulated among accessions

  • Functional Consequences:

    • Variation in dolichol levels may affect protein glycosylation efficiency

    • Different glycosylation patterns could contribute to phenotypic diversity among accessions

    • Altered dolichol profiles may influence adaptation to specific environmental conditions

This natural variation provides an opportunity to identify high-dolichol-accumulating accessions that could serve as a basis for developing plants with enhanced dolichol content, potentially useful for addressing dolichol deficiency in humans .

How can metabolic engineering of DPS be utilized to enhance dolichol production in plants?

Metabolic engineering strategies targeting DPS can significantly enhance dolichol production in plants through several complementary approaches:

  • Genetic Engineering Approaches:

    • Overexpression strategies:

      • Constitutive overexpression of DPS using strong promoters

      • Tissue-specific overexpression targeting roots where DPS is naturally highly expressed

      • Co-expression of DPS with other rate-limiting enzymes in the pathway

    • Gene editing approaches:

      • CRISPR/Cas9 modification of regulatory regions to enhance expression

      • Targeted mutations to increase enzyme stability or activity

      • Modification of substrate binding sites to enhance catalytic efficiency

  • Pathway Engineering:

    • Increasing flux through the MVA pathway by overexpressing HMG-CoA reductase, a key regulatory enzyme

    • Downregulating competing branches of isoprenoid metabolism to channel precursors toward dolichol production

    • Co-expression of DPS with the α/β-hydrolase encoded by AT1G52460, which has been implicated in dolichol accumulation

  • Synthetic Biology Approaches:

    • Construction of synthetic pathways with optimized enzyme combinations

    • Development of feedback-resistant enzyme variants

    • Creation of subcellular compartments for pathway optimization

  • Cultivation Strategies:

    • Optimization of growth conditions that enhance dolichol accumulation

    • Strategic harvesting at developmental stages with peak dolichol production

    • Application of elicitors that increase isoprenoid metabolism

Successful engineering could generate dolichol-enriched plants with potential applications as biofactories for producing these valuable compounds. Such plants might serve as a remedy for dolichol-deficiency in humans, as suggested by research into dolichol accumulation determinants in Arabidopsis .

What are the implications of DPS research for understanding and treating human dolichol-related disorders?

Research on Arabidopsis DPS has significant implications for understanding and addressing human dolichol-related disorders:

  • Mechanistic Insights for Human Disease:

    • Plant systems provide simplified models to understand fundamental aspects of dolichol biosynthesis

    • Research on Arabidopsis DPS reveals conserved enzymatic mechanisms that apply to human systems

    • Understanding structure-function relationships in plant enzymes can inform human disease mechanisms

  • Relevance to Human Disorders:

    • Missense mutations in the human DHDDS gene are responsible for certain variants of retinitis pigmentosa

    • Since DHDDS is involved in the early steps of dolichol synthesis required for N-glycosylation, related diseases are classified as congenital disorders of glycosylation (CDG)

    • Many CDG subtypes present with retinitis pigmentosa as a major feature

  • Therapeutic Development Opportunities:

    • Plants engineered for enhanced dolichol production could serve as production platforms for compounds to treat deficiency disorders

    • Structural insights from plant enzymes could enable rational drug design targeting human enzymes

    • Understanding regulatory mechanisms in plants might inform therapeutic strategies for modulating dolichol levels

  • Translational Research Directions:

    • Development of plant biofactories for dolichol production

    • Creation of model systems for testing interventions in dolichol metabolism

    • Identification of small molecule modulators of enzyme activity with potential therapeutic applications

The genetic and biochemical characterization of plant DPS enzymes provides valuable insights that can be translated to human health applications, particularly for rare disorders affecting dolichol biosynthesis and protein glycosylation.

How can comparative genomics inform our understanding of DPS evolution and function across species?

Comparative genomics approaches offer powerful insights into the evolution and function of DPS across different species:

  • Evolutionary Conservation and Divergence:

    • Alignment of DPS sequences from diverse organisms reveals conserved catalytic motifs essential for function

    • Species-specific variations may indicate adaptations to different cellular environments or metabolic requirements

    • Phylogenetic analysis can trace the evolutionary history of DPS and related cis-prenyltransferases

  • Functional Inference:

    • Function of uncharacterized DPS homologs can be predicted based on sequence similarity to characterized enzymes

    • Identification of conserved substrate-binding residues provides insights into enzymatic mechanism

    • Correlation between sequence features and product specificity (chain length) reveals structure-function relationships

  • Genomic Context Analysis:

    • Examination of neighboring genes can reveal functional associations or co-regulated gene clusters

    • Comparison of promoter regions may identify conserved regulatory elements

    • Analysis of intron-exon structures provides insights into gene evolution

  • Practical Applications:

    • Identification of orthologs with desired properties (enhanced activity, stability, etc.)

    • Design of chimeric enzymes combining beneficial features from different species

    • Targeted mutagenesis based on insights from natural sequence diversity

The systematic comparison of DPS enzymes across plants, animals, and fungi has revealed both conserved features essential for catalytic function and lineage-specific adaptations that may reflect different cellular requirements for dolichol and protein glycosylation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.