Recombinant Arabidopsis thaliana Delta-9 acyl-lipid desaturase 1 (ADS1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Metabolism

Catalytic Activity

  • Substrate: 16:0/18:0 acyl groups esterified to membrane lipids

  • Reaction: Stearoyl-CoA+2Fe2++O2Oleoyl-CoA+2Fe3++2H2O\text{Stearoyl-CoA} + 2 \text{Fe}^{2+} + O_2 \rightarrow \text{Oleoyl-CoA} + 2 \text{Fe}^{3+} + 2 H_2O

  • Temperature Sensitivity:

    • Activity decreases by 40% at 10°C compared to 25°C

    • Cold-induced downregulation (3-fold reduction at 4°C)

Tissue-Specific Expression

TissueExpression LevelRegulatory Factors
InflorescenceHighDevelopmental stage
LeavesHighLight cycles
RootsLowAbscisic acid
SeedsModerateWRINKLED1 (WRI1)

Key Research Findings

Genetic Manipulation Studies

Study FocusExperimental ModelOutcomeReference
ADS1 overexpressionYeast (OLE1 disruption)Restored Δ9 desaturation activity; 18:1↑27%
Antisense suppressionArabidopsis fab1 fael16:0↑18%, 18:0↑22% in seed oil
Chloroplast retargetingTransgenic tobaccoShifted substrate specificity to Δ7 desaturation (16:1Δ7↑15%)

Biotechnological Applications

  • Oilseed Modification: Co-expression with MGDG synthase increased polyunsaturated fatty acids by 34% in yeast models

  • Cold Tolerance Engineering: RNAi-mediated ADS1 suppression improved frost resistance in Arabidopsis

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please include them in your order notes, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
ADS1; At1g06080; T21E18.13; Delta-9 acyl-lipid desaturase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ADS1
Target Protein Sequence
MSLSASEKEENNKKMAADKAEMGRKKRAMWERKWKRLDIVKAFASLFVHFLCLLAPFNFT WPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTH RYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGRRTNVEDLKRQWYYKFLQRTV LYHILTFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHVWGSRTWKTNDTSRNVW WLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR MAMVR
Uniprot No.

Target Background

Function
This protein is involved in the delta-9 desaturation of fatty acids.
Gene References Into Functions
  1. ADS1-mediated alteration of chloroplast membrane fluidity is crucial for initiating a cold acclimation (CA) response. This serves as an upstream event for cytosolic calcium signaling. PMID: 27062193
Database Links

KEGG: ath:AT1G06080

STRING: 3702.AT1G06080.1

UniGene: At.342

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in inflorescence meristems, leaves, and flowers, and weakly in roots and seedpods.

Q&A

What is Delta-9 acyl-lipid desaturase 1 (ADS1) in Arabidopsis thaliana?

Delta-9 acyl-lipid desaturase 1 (ADS1) is a protein encoded by the ADS1 gene (At1g06080) in Arabidopsis thaliana. It functions as a desaturase enzyme that introduces double bonds into fatty acid chains, specifically involved in membrane lipid modification. The protein has 305 amino acids and is characterized by its role in modulating membrane fluidity in response to temperature changes . ADS1 is classified as an EC 1.14.19.- enzyme, indicating its activity as an oxidoreductase acting on paired donors with incorporation of molecular oxygen.

Where is ADS1 localized within plant cells?

Subcellular localization studies using both C- and N-terminal enhanced-fluorescence-fusion proteins have conclusively demonstrated that ADS1 localizes exclusively to chloroplasts . This chloroplast localization is consistent with its role in modifying membrane lipids in this organelle. Its specific localization distinguishes it from other related desaturases like ADS2, which primarily localizes to the endoplasmic reticulum with some presence in Golgi and plastids . The exclusive chloroplast localization of ADS1 suggests a specialized role in modifying chloroplast membrane lipids, particularly affecting thylakoid membrane composition and fluidity.

How does ADS1 function in cold acclimation response?

ADS1 plays a critical role in priming the cold acclimation response in Arabidopsis thaliana. Research has revealed that ADS1-mediated alteration of chloroplast membrane fluidity is an upstream event in the cold acclimation process, occurring before cytosolic calcium signaling . Interestingly, knockout of the ADS1 gene enhances freezing tolerance after cold acclimation, suggesting a complex regulatory role.

The mechanism involves changes in membrane lipid composition that affect membrane fluidity at normal growth temperatures. When plants experience cold stress, the altered membrane properties in ads1 mutants appear to trigger an enhanced calcium signaling response, with the cytosolic calcium content in these mutants being approximately two times higher than in wild-type plants . This amplified calcium signal likely activates downstream cold response pathways more effectively, ultimately resulting in improved freezing tolerance after the acclimation period.

How does ADS1 affect membrane lipid composition?

ADS1 significantly influences membrane lipid composition by modulating the desaturation of fatty acids. Detailed analysis shows that in ads1 mutant plants grown at 23°C, the 18:1 (oleic acid) content was 20% lower than in wild-type plants . This indicates that ADS1 is involved in either the synthesis or preservation of 18:1 fatty acids in membrane lipids.

Lipidomics analysis provided further insights, revealing that 34C-species of monogalactosyl diacylglycerol (MGDG) content in ads1 mutants were 3.3–14.9% lower than in wild-type . Additionally, positional analysis identified 10% lower 18:1 fatty acid content specifically at the sn-2 position of MGDG in the mutant compared to wild-type, suggesting position-specific activity of ADS1 .

The table below summarizes the key lipid composition differences between wild-type and ads1 mutant plants:

Lipid ParameterWild-type (23°C)ads1 Mutant (23°C)After Cold Acclimation
18:1 ContentBaseline20% lowerNo significant difference
34C-MGDG SpeciesBaseline3.3-14.9% lowerNo significant difference
18:1 at sn-2 of MGDGBaseline10% lowerNo significant difference

Notably, these biochemical differences between wild-type and ads1 mutant plants disappear after cold acclimation , suggesting that ADS1's influence on lipid composition is most significant under normal growth temperatures.

How does ADS1 compare functionally with other acyl-lipid desaturases?

ADS1, ADS2, and ADS3 (also known as FAD5) are all acyl-lipid desaturases in Arabidopsis thaliana but differ significantly in their substrate specificity, subcellular localization, and physiological roles:

FeatureADS1ADS2ADS3 (FAD5)
Subcellular LocalizationChloroplasts Primarily endoplasmic reticulum, some in Golgi and plastids Plastids
Desaturation PositionDelta-9 16:0 desaturase of MGDG and PG Delta-7 desaturase of 16:0 on MGDG at sn-2 position
Response to ColdPrimes cold acclimation Essential for cold stress response Involved in chilling sensitivity
Effect of MutationEnhanced freezing tolerance after cold acclimation Growth defects under low temperature Lower levels of 16:1, 16:2, and 16:3; higher level of 16:0
Preference for Lipid ClassMGDG MGDG and PG MGDG
Position SpecificityPreference for sn-2 position Not fully characterizedSpecific to sn-2 position

This comparison highlights the complementary yet distinct roles of these desaturases in lipid metabolism and stress responses. While ADS3 is clearly established as responsible for the Delta-7 desaturation of 16:0 on MGDG at the sn-2 position , and ADS2 appears to function as a 16:0 desaturase affecting both MGDG and PG , ADS1 seems to have a more regulatory role in cold acclimation, potentially through its effects on 18:1 content at the sn-2 position of MGDG .

What methods are effective for studying ADS1 function in Arabidopsis?

Several methodological approaches have proven effective for studying ADS1 function:

  • Genetic Knockout Studies: T-DNA insertion mutants have been successfully used to create ads1 knockout lines for functional analysis . This approach allows researchers to observe phenotypic and biochemical changes resulting from the absence of ADS1.

  • Fatty Acid Composition Analysis: Gas chromatography techniques provide detailed analysis of changes in fatty acid profiles, particularly focusing on 18:1 content differences between wild-type and mutant plants . This method is essential for understanding ADS1's impact on membrane lipid composition.

  • Lipidomics Analysis: Mass spectrometry-based approaches enable comprehensive characterization of changes in membrane lipid composition, especially examining MGDG species differences . This technique provides a holistic view of how ADS1 affects the lipidome.

  • Subcellular Localization Studies: Fluorescent protein fusion constructs (C- and N-terminal enhanced-fluorescence-fusion proteins) have been used to precisely determine the subcellular localization of ADS1 to chloroplasts . This method clarifies the cellular context of ADS1 function.

  • Cold Acclimation Experiments: Controlled temperature regimes are used to study physiological responses to cold stress and measure freezing tolerance in both wild-type and ads1 mutant plants . These experiments reveal ADS1's role in temperature adaptation.

  • Calcium Signaling Analysis: Techniques for measuring cytosolic calcium content in response to cold shock establish connections between ADS1 function and signaling pathways . This approach helps elucidate the mechanism by which ADS1 affects cold acclimation.

What are the optimal conditions for recombinant ADS1 protein expression and storage?

For the successful expression, purification, and storage of recombinant ADS1 protein:

  • Expression Systems: While specific expression systems for ADS1 are not detailed in the provided search results, recombinant proteins from Arabidopsis are typically expressed in either E. coli, yeast, or insect cell systems depending on the required post-translational modifications and functional assays.

  • Purification Tags: The tag type for ADS1 is typically determined during the production process based on optimal expression and purification outcomes . Common tags include His-tag, GST, or MBP depending on the specific requirements of downstream applications.

  • Storage Buffer: The optimal storage buffer for recombinant ADS1 consists of a Tris-based buffer with 50% glycerol, specifically optimized for this protein's stability . This high glycerol content helps prevent protein denaturation during freezing.

  • Storage Temperature: Recombinant ADS1 protein should be stored at -20°C, and for extended storage, it should be conserved at -20°C or -80°C . Working aliquots can be maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles.

  • Handling Precautions: Repeated freezing and thawing of the protein should be avoided as it may lead to denaturation and loss of activity . Preparing single-use aliquots before freezing is recommended to maintain protein integrity.

How can researchers design effective experiments to study ADS1's role in cold acclimation?

To effectively investigate ADS1's role in cold acclimation, researchers should consider the following experimental design approaches:

  • Comparative Phenotypic Analysis: Design experiments that compare wild-type and ads1 mutant plants under various temperature regimes, including normal growth temperature (e.g., 23°C), cold acclimation (e.g., 6°C for several days), and freezing stress (e.g., -4°C to -8°C) . Measure survival rates, electrolyte leakage, and visible damage to assess freezing tolerance.

  • Time-Course Studies: Implement time-course experiments during cold acclimation to track the dynamic changes in lipid composition, gene expression, and signaling molecules. This approach can reveal the temporal sequence of events following ADS1 disruption.

  • Biochemical Analysis at Different Temperatures: Perform fatty acid composition and lipidomics analysis on plants grown at normal temperature and after cold acclimation . This comparative approach will highlight the temperature-dependent effects of ADS1 on lipid metabolism.

  • Calcium Signaling Measurements: Design experiments to measure cytosolic calcium dynamics in response to cold shock in both wild-type and ads1 mutant plants . Use calcium-sensitive fluorescent dyes or genetically encoded calcium indicators to visualize and quantify calcium signals.

  • Complementation Studies: Include complementation lines where the ads1 mutation is rescued by expression of a functional ADS1 gene to confirm that observed phenotypes are directly attributable to ADS1 function.

  • Double Mutant Analysis: Create and analyze double mutants with other desaturases (e.g., ads1/ads2 or ads1/ads3) to investigate functional redundancy or synergistic effects between different acyl-lipid desaturases .

How does ADS1 integrate into cold stress signaling networks?

ADS1 appears to be a critical component in the plant's cold stress signaling network, functioning at the interface between membrane sensing and intracellular signaling cascades:

  • Membrane Fluidity Sensor: ADS1's role in modulating chloroplast membrane lipid composition suggests it may function as part of a membrane fluidity sensing mechanism that detects temperature changes . The altered lipid composition in ads1 mutants changes the membrane's physical properties, potentially affecting how temperature shifts are perceived.

  • Upstream of Calcium Signaling: Research demonstrates that ADS1 functions upstream of calcium signaling pathways, as evidenced by the approximately two-times higher cytosolic calcium content in ads1 mutant plants compared to wild-type in response to cold shock . This places ADS1 early in the cold response signaling cascade.

  • Retrograde Signaling Component: The chloroplast localization of ADS1 coupled with its effects on cytosolic calcium levels suggests involvement in retrograde signaling from chloroplasts to the nucleus, potentially influencing nuclear gene expression in response to temperature changes.

  • Integrated Desaturase Network: ADS1 functions within a network of desaturases including ADS2 and ADS3, which together modulate membrane lipid composition in different cellular compartments . This coordinated action suggests a sophisticated cellular response to temperature changes involving multiple organelles.

  • Cold Acclimation Priming: The fact that ads1 knockout enhances freezing tolerance after cold acclimation suggests that ADS1 may normally regulate or limit certain aspects of the cold acclimation response, possibly serving as a modulator that fine-tunes the magnitude of the response.

What are the unresolved contradictions in current ADS1 research?

Several important contradictions and unresolved questions exist in the current understanding of ADS1 function:

  • Enhanced Freezing Tolerance in Knockout Mutants: Perhaps the most intriguing contradiction is that knockout of the ADS1 gene enhances freezing tolerance after cold acclimation . This seems paradoxical since membrane lipid desaturation is generally associated with increased cold tolerance, yet the loss of a desaturase improves freezing resistance. This suggests ADS1 may have regulatory functions beyond direct membrane modification.

  • Disappearance of Phenotypes After Acclimation: The biochemical differences between wild-type and ads1 mutant plants (in terms of 18:1 content, MGDG composition, and calcium signaling) disappear after cold acclimation . This indicates that ADS1's role may be specific to the initial response to cold stress rather than the fully acclimated state, but the mechanism behind this transition remains unclear.

  • Substrate Specificity Questions: While ADS1 appears to affect 18:1 content at the sn-2 position of MGDG , its precise substrate specificity and enzymatic mechanism remain incompletely characterized compared to those of ADS3, which is clearly established as a Delta-7 desaturase specific for 16:0 on MGDG .

  • Temperature-Dependent Activity: The temperature dependence of ADS1 activity is not fully understood. It appears to influence lipid composition at normal growth temperatures but has diminished effects after cold acclimation . The molecular basis for this temperature sensitivity requires further investigation.

  • Signaling vs. Structural Role: It remains unclear whether ADS1's primary function in cold response is structural (directly modifying membrane properties) or regulatory (triggering signaling cascades). The enhanced calcium signaling in ads1 mutants suggests a regulatory role, but the mechanism connecting membrane lipid changes to calcium flux is not well defined.

How might advanced techniques advance our understanding of ADS1 function?

Several cutting-edge techniques could significantly advance our understanding of ADS1 function:

  • CRISPR-Cas9 Gene Editing: Precise editing of specific domains within the ADS1 gene could help identify critical regions for substrate binding, catalytic activity, or protein-protein interactions. This approach allows for more subtle manipulations than complete gene knockouts.

  • Cryo-Electron Microscopy: This technique could provide high-resolution structural information about ADS1 in its native chloroplast membrane environment, potentially revealing how it interacts with lipid substrates and other proteins.

  • Proximity-Based Labeling: Techniques such as BioID or APEX2 could identify proteins that interact with or are proximal to ADS1 in vivo by fusing ADS1 with a biotin ligase or peroxidase enzyme. This would help map the ADS1 interactome under different temperature conditions.

  • Single-Cell Lipidomics: Emerging techniques for single-cell analysis could reveal cell-type specific effects of ADS1 on lipid composition, potentially uncovering specialized roles in different tissues or cell types.

  • Live-Cell Imaging of Membrane Dynamics: Advanced microscopy techniques combining fluorescent membrane probes with labeled ADS1 could visualize real-time changes in membrane properties during temperature shifts, connecting ADS1 activity directly to membrane physical states.

  • Optogenetic Control of ADS1: Developing light-controlled versions of ADS1 would allow precise temporal control over its activity, enabling researchers to dissect the immediate downstream effects of ADS1 activation or inactivation.

  • Molecular Dynamics Simulations: Computational modeling of ADS1 within chloroplast membranes could predict how its activity affects membrane physical properties and how these changes might influence embedded proteins like calcium channels.

How should researchers interpret fatty acid composition data in ADS1 studies?

When interpreting fatty acid composition data in ADS1 studies, researchers should consider the following methodological approaches and interpretative frameworks:

  • Statistical Analysis of Replicates: Ensure rigorous statistical analysis of fatty acid composition data, typically using ANOVA followed by appropriate post-hoc tests. The 20% lower 18:1 content observed in ads1 mutants should be evaluated for statistical significance across multiple biological replicates.

  • Temperature-Dependent Effects: Always analyze fatty acid composition at multiple temperatures, as the effects of ADS1 appear to be temperature-dependent. The disappearance of compositional differences after cold acclimation highlights the importance of comparative analysis across temperature conditions.

  • Positional Isomer Differentiation: Use techniques that can distinguish fatty acid positional isomers, as ADS1 appears to specifically affect the sn-2 position of glycerolipids . This requires specialized analytical methods beyond basic fatty acid methyl ester (FAME) analysis.

  • Lipid Class Separation: Separate and analyze different lipid classes (e.g., MGDG, DGDG, PG) individually rather than analyzing total fatty acids, as ADS1 shows specificity for certain lipid classes, particularly MGDG .

  • Integration with Physiological Data: Correlate fatty acid composition changes with physiological parameters such as membrane fluidity measurements, freezing tolerance, or calcium signaling responses to establish functional relevance of the observed lipid alterations.

  • Comparative Analysis with Other Desaturase Mutants: Compare ads1 mutant fatty acid profiles with those of other desaturase mutants (e.g., ads2, ads3/fad5) to identify specific signatures of ADS1 activity versus other desaturases .

What does ADS1's role reveal about the relationship between membrane composition and cold tolerance?

The study of ADS1 has revealed several important insights about the relationship between membrane composition and cold tolerance:

How can researchers effectively design experiments to resolve contradictions in ADS1 function?

To address current contradictions and unresolved questions about ADS1 function, researchers should consider these experimental design strategies:

  • Time-Course Experiments: Design detailed time-course experiments that track changes in membrane composition, calcium signaling, and gene expression at multiple time points after cold exposure. This approach could reveal how the initial advantages of the ads1 mutation transition to similar phenotypes as wild-type after complete acclimation .

  • Genetic Suppressor Screens: Perform suppressor screens in the ads1 mutant background to identify genes that, when mutated, reverse the enhanced freezing tolerance phenotype. This could reveal downstream components of the ADS1-regulated pathway.

  • Inducible Expression Systems: Develop inducible expression systems for ADS1 that allow temporal control of its activity during different phases of cold acclimation. This would help distinguish between ADS1's roles in initial cold perception versus sustained acclimation.

  • Synthetic Biology Approaches: Create chimeric proteins by swapping domains between ADS1 and other desaturases (ADS2, ADS3) to identify the specific regions responsible for substrate specificity, localization, and temperature responsiveness.

  • Multifactorial Stress Experiments: Test ads1 mutants under combinations of stresses (e.g., cold + high light, cold + drought) to uncover potential roles of ADS1 in integrating multiple stress responses, which might explain some of the seemingly contradictory observations.

  • Single-Cell Resolution Studies: Investigate whether ADS1 functions differently in specific cell types or tissues, which could explain apparently contradictory whole-plant phenotypes if effects are cell-type specific.

  • Direct Enzyme Activity Assays: Develop in vitro assays for direct measurement of ADS1 desaturase activity at different temperatures using purified recombinant protein and defined lipid substrates. This would clarify the temperature-dependence of its enzymatic function.

What are promising directions for ADS1 research beyond cold stress responses?

While ADS1 has been primarily studied in the context of cold acclimation, several promising research directions extend beyond temperature responses:

  • Light Stress Interactions: Investigate potential roles of ADS1 in photosynthetic membrane adaptation to varying light conditions. As a chloroplast-localized desaturase , ADS1 could influence thylakoid membrane properties crucial for photosynthetic efficiency under different light regimes.

  • Developmental Regulation: Explore ADS1 expression and function throughout plant development to determine if it has stage-specific roles in membrane biogenesis or remodeling beyond stress responses.

  • Hormone Signaling Integration: Examine interactions between ADS1-mediated lipid modifications and hormone signaling pathways, particularly abscisic acid, which is involved in multiple stress responses and may intersect with membrane-based signaling.

  • Pathogen Response Involvement: Investigate whether ADS1-mediated changes in chloroplast membrane composition affect plant immune responses, as chloroplasts are increasingly recognized as important hubs in plant immunity.

  • Evolution of Desaturase Functions: Conduct comparative studies of ADS1 orthologs across plant species with varying cold tolerance to understand how desaturase functions have evolved and diversified.

  • Metabolic Network Integration: Explore connections between ADS1 activity and broader metabolic networks, including potential impacts on photosynthetic efficiency, energy metabolism, and retrograde signaling pathways.

  • Novel Desaturase Applications: Investigate potential biotechnological applications of ADS1 for modifying lipid composition in crop plants or production systems, potentially creating plants with enhanced stress resilience or altered oil composition.

How might molecular breeding approaches target ADS1 for crop improvement?

Based on our understanding of ADS1 function, several molecular breeding strategies could be employed for crop improvement:

  • Knockout or Downregulation Strategies: Given that ads1 knockout enhances freezing tolerance after cold acclimation in Arabidopsis , similar modifications in crop species might improve cold tolerance. CRISPR-Cas9 editing could be used to create precise mutations in ADS1 orthologs in crops.

  • Promoter Engineering: Modifying the promoter regions of ADS1 orthologs could create crops with altered expression patterns, potentially enhancing cold acclimation responses while minimizing potential yield penalties under normal conditions.

  • Allele Mining and Selection: Explore natural variation in ADS1 genes across germplasm collections of major crops to identify naturally occurring variants with improved properties for stress adaptation.

  • Domain Swapping: Engineer chimeric proteins by combining domains from ADS1 homologs from cold-hardy plant species with crop ADS1 proteins to introduce beneficial functional properties.

  • Dosage Optimization: Fine-tune ADS1 expression levels to achieve optimal balance between stress protection and normal growth. Complete knockout might not be ideal in all crop contexts, so creating allelic series with varying expression levels could identify optimal configurations.

  • Tissue-Specific Modification: Develop tissue-specific or stress-inducible expression systems for modified ADS1 variants to limit modifications to critical tissues or stress conditions.

  • Stacking with Other Desaturase Modifications: Combine ADS1 modifications with alterations to other desaturases (such as ADS2 or ADS3 homologs) to engineer comprehensive membrane adaptation systems for enhanced stress resilience.

What technological advances would facilitate deeper understanding of ADS1 mechanisms?

Several emerging technologies could significantly advance our understanding of ADS1 mechanisms:

  • High-Resolution Lipidomics: Advanced mass spectrometry techniques with improved sensitivity and throughput would enable more comprehensive profiling of membrane lipid changes mediated by ADS1, potentially revealing subtle modifications currently below detection limits.

  • Single-Molecule Enzyme Kinetics: Technologies for studying single enzyme molecules could reveal the catalytic mechanism and substrate interactions of ADS1 in unprecedented detail, potentially explaining its temperature-dependent activity.

  • Membrane Biophysics Tools: Advanced techniques for measuring membrane physical properties (fluidity, thickness, domain formation) at nanoscale resolution would help connect ADS1-mediated lipid changes to functional membrane properties.

  • In situ Structural Biology: Developments in cellular cryo-electron tomography could allow visualization of ADS1 structure and interactions within intact chloroplast membranes, providing contextual information about its native environment.

  • Multi-omics Integration Platforms: Computational tools that can integrate lipidomics, transcriptomics, proteomics, and metabolomics data would help place ADS1 function within the broader cellular response network during cold acclimation.

  • Real-time Metabolic Flux Analysis: Techniques for tracking lipid metabolism in real-time using stable isotope labeling could reveal the dynamic aspects of ADS1 function during temperature transitions.

  • Synthetic Membrane Systems: Engineered membrane mimetics containing purified ADS1 could serve as simplified experimental systems for precise manipulation and measurement of enzymatic activity under controlled conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.