Recombinant Arabidopsis thaliana Delta-9 acyl-lipid desaturase 2 (ADS2)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics of Recombinant ADS2

Recombinant ADS2 is a plastid- and endoplasmic reticulum-associated enzyme with Δ⁹ desaturase activity. Key features include:

  • Gene locus: Encoded by At2g31360 (ADS2) in Arabidopsis thaliana .

  • Protein structure: Contains 307 amino acids with a conserved histidine-rich motif critical for desaturase activity .

  • Recombinant expression: Produced in cell-free systems with ≥85% purity, stabilized in Tris-based buffer with 50% glycerol for storage at -20°C .

  • Catalytic activity: Preferentially desaturates 16:0 (palmitic acid) at the Δ⁹ position to produce 16:1Δ⁷ (ω-7) fatty acids, but also acts on very-long-chain fatty acids (VLCFAs) .

Functional Roles in Plant Physiology

ADS2 plays critical roles in membrane lipid adaptation and stress responses:

Low-Temperature Adaptation

  • ADS2 remodels membrane lipids by increasing unsaturated fatty acids during cold exposure.

  • ads2 mutants exhibit reduced 16:2 and 16:3 fatty acids (by 26–35%) and elevated 16:0 levels (by 26–30%) at 6°C compared to wild-type plants .

  • Double mutants of ads2 and plastidic ADS3 show exacerbated growth defects under cold stress, indicating functional redundancy .

Membrane Lipid Biosynthesis

  • Localizes to the endoplasmic reticulum (ER) and Golgi, with minor plastid association .

  • Modifies acyl groups in monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG) lipids .

Table 1: Fatty Acid Composition in ads2 Mutants vs. Wild-Type at 6°C

Fatty AcidWild-Type (%)ads2-2 Mutant (%)ads2-3 Mutant (%)
16:018.123.824.1
16:1Δ⁷4.22.11.9
16:212.39.18.9
16:315.611.410.8

Key Findings:

  • Substrate specificity: ADS2 exhibits 40-fold lower activity on 18:0-ACP compared to SSI2 (another Δ⁹ desaturase), but compensates by targeting 16:0-ACP and VLCFAs .

  • Genetic interactions: Double mutants (aad3 ssi2) reveal SSI2 primarily desaturates 18:0-ACP, while ADS2 dominates in 16:0-ACP modification .

  • Cold-induced expression: ADS2 mRNA levels increase under cold stress, contrasting with downregulation of its homolog ADS1 .

Applications and Research Tools

  • Protein purification: Recombinant ADS2 is available commercially for in vitro assays (e.g., ELISA), aiding studies on lipid desaturation mechanisms .

  • Biotechnological potential: Engineered ADS2 variants could enhance cold tolerance in crops by modulating membrane fluidity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for preferential development.
Synonyms
ADS2; At2g31360; T28P16.15; Delta-9 acyl-lipid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ADS2
Target Protein Sequence
MSVTSTVEENHQKNPSTPAAVEEKKKRRWVFWDRRWRRLDYVKFSASFTVHSLALLAPFY FTWSALWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVS THRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAYLVSKCGRRANVEDLKRQWFYRFLQK TVLFHILGLGFFLFYLGGMSFVTWGMGVGAALEVHVTCLINSLCHIWGTRTWKTNDTSRN VWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQR RRMAIVR
Uniprot No.

Target Background

Function
Involved in the delta-9 desaturation of fatty acids.
Gene References Into Functions
  • Studies indicate that ADS2 is crucial for adjusting the acyl composition of organelle membrane lipids in response to cold stress. PMID: 23585650
  • AtADS2 participates in the synthesis of glycerolipids and sphingolipids in seeds. PMID: 23175755
Database Links

KEGG: ath:AT2G31360

STRING: 3702.AT2G31360.1

UniGene: At.14455

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in flowers, roots, leaves, seedpods, and inflorescence meristems.

Q&A

What is ADS2 and what is its primary function in Arabidopsis thaliana?

ADS2 (ACYL-LIPID DESATURASE2) is a protein in Arabidopsis thaliana that belongs to a family of nine ADS proteins with homology to the Δ9 acyl-lipid desaturases of cyanobacteria and the Δ9 acyl-CoA desaturases of yeast and mammals . The primary function of ADS2 is regulating membrane lipid desaturation in response to low-temperature exposure . ADS2 can desaturate 16:0 (palmitic acid) at the Δ9 position and has also been shown to produce ω-7 very long chain fatty acids (VLCFAs) . This desaturation activity is critical for maintaining membrane fluidity during cold stress, which is essential for plant survival at low temperatures .

How is ADS2 expression regulated in Arabidopsis?

ADS2 expression is organ-dependent and significantly regulated by temperature conditions . Cold temperature up-regulates ADS2 expression, which contrasts with the down-regulation of ADS1 expression under similar conditions . This expression pattern suggests that ADS2 plays a specialized role in cold acclimation or chilling tolerance . Studies have shown that ADS2 expression is quickly induced when plants are shifted from 22°C to 10°C, further supporting its involvement in the plant's response to temperature decrease .

What phenotypes do ads2 mutant plants exhibit under various growth conditions?

The reproductive phenotype is particularly striking: while ads2 mutants begin bolting at a similar time to wild-type plants, all four ads2 mutant lines studied were sterile at 6°C, whereas wild-type plants produced abundant, viable seeds . This sterility appears to be partly due to the failure of anthers to open after flowering in ads2 mutants . Interestingly, when flowering ads2 mutants were moved from 6°C to room temperature, the dwarf and sterility phenotypes were partially suppressed, indicating that these phenotypes are specifically related to cold stress response .

How does ADS2 contribute to membrane lipid remodeling during cold stress?

ADS2 plays a crucial role in membrane lipid remodeling during cold stress by altering the fatty acid composition of membrane lipids . When exposed to low temperatures, plants increase membrane fluidity through enhanced membrane lipid unsaturation, which helps maintain membrane function under cold conditions .

In ads2 mutants, analysis of lipid compositions revealed altered proportions of various membrane lipids compared to wild-type plants. The levels of monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG) were lower in ads2 mutants, while levels of phosphatidic acid, phosphatidylinositol, phosphatidylethanolamine, phosphatidylcholine, lyso-phosphatidylcholine, and phosphatidylserine were higher than in wild-type plants . These alterations in membrane lipid composition likely contribute to the reduced cold tolerance observed in ads2 mutants.

What is the relationship between ADS2 and freezing tolerance in Arabidopsis?

ADS2 contributes significantly to freezing tolerance in Arabidopsis. Freezing tolerance experiments have shown that ads2 mutant plants have a lower survival rate than wild-type plants when exposed to freezing temperatures between -7°C and -12°C . The temperature at which 50% survival occurred was -10.0°C for wild-type plants, compared to -8.0°C for ads2-2 mutants and -7.9°C for ads2-3 mutants .

How does ADS2 function relate to other desaturases in Arabidopsis?

ADS2 is part of a complex network of desaturases in Arabidopsis. The Arabidopsis genome encodes a group of nine ADS proteins with homology to Δ9 desaturases, along with other desaturase families like the AAD (ACYL-ACYL CARRIER PROTEIN DESATURASE) family, which includes seven members .

Among these desaturases, ADS3 (also known as FAD5) has been well-studied and encodes a plastidic palmitoyl-monogalactosyldiacylglycerol Δ7 desaturase . A double mutation with ADS3 exacerbates the growth defects of ads2 mutant plants under low temperature, suggesting functional relationships between these desaturases .

Another important desaturase is FAD2, which encodes a microsomal oleoyl-phosphatidylcholine desaturase involved in the production of polyunsaturated fatty acids . While ADS2 primarily acts on 16:0 (palmitic acid), other desaturases like SSI2 have greater activity on 18:0-ACP (stearic acid) .

What approaches can be used to study ADS2 function in Arabidopsis?

Several experimental approaches have been employed to study ADS2 function:

  • Genetic approaches: Generation and characterization of ads2 mutants through T-DNA insertion or other mutagenesis methods . Multiple alleles (ads2-1, ads2-2, ads2-3, and ads2-4) have been studied to confirm phenotypes .

  • Expression analysis: Monitoring ADS2 expression under different conditions, particularly in response to temperature changes .

  • Subcellular localization: Using C- and N-terminal enhanced fluorescence fusion proteins to determine the cellular compartments where ADS2 functions .

  • Lipid analysis: Comprehensive analysis of membrane lipid composition in wild-type and ads2 mutant plants to identify specific changes in lipid profiles .

  • Physiological assays: Assessing plant growth, development, and stress responses under various temperature conditions .

  • Heterologous expression: Expressing ADS2 in yeast to confirm its desaturase activity and substrate specificity .

How can recombinant ADS2 be expressed and characterized?

Recombinant ADS2 can be expressed in heterologous systems to study its enzymatic activity and substrate specificity. Based on previous studies with related desaturases, the following approach can be effective:

  • Cloning: The ADS2 coding sequence can be amplified from Arabidopsis cDNA and cloned into an appropriate expression vector, such as those used for yeast or bacterial expression systems .

  • Expression systems: Yeast systems, particularly Saccharomyces cerevisiae, have been successfully used to express plant desaturases including ADS2 . Yeast cells lack endogenous Δ9 desaturase activity for certain substrates, making them suitable for functional characterization.

  • Activity assays: After expression, desaturase activity can be assessed by analyzing the fatty acid composition of the expression host. Gas chromatography (GC) or GC-MS can be used to detect the formation of unsaturated fatty acids .

  • Substrate specificity: Different fatty acid substrates can be supplied to determine the specificity of ADS2. Previous studies have shown that ADS2 can desaturate 16:0 at the Δ9 position and produce ω-7 VLCFAs .

What methodologies are used to analyze lipid composition changes in ads2 mutants?

Analyzing lipid composition changes in ads2 mutants requires sophisticated analytical techniques. The following methods have been employed:

  • Lipid extraction: Total lipids are extracted from plant tissues using established protocols such as the Bligh and Dyer method or modifications thereof.

  • Thin-layer chromatography (TLC): This technique can separate different lipid classes based on their polarity.

  • Gas chromatography (GC): After methylation to form fatty acid methyl esters (FAMEs), the fatty acid composition can be analyzed by GC. This method is particularly useful for distinguishing between saturated and unsaturated fatty acids and determining their relative abundances .

  • Mass spectrometry (MS): Techniques such as electrospray ionization mass spectrometry (ESI-MS) or tandem mass spectrometry (MS/MS) provide detailed information about lipid molecular species and their structures.

  • Quantitative analysis: The relative abundances of different lipid species can be quantified to identify specific changes in lipid profiles between wild-type and mutant plants .

How should researchers interpret changes in lipid profiles in ads2 mutant studies?

When interpreting changes in lipid profiles of ads2 mutants, researchers should consider the following aspects:

  • Membrane-specific changes: Different membrane systems (e.g., plasma membrane, ER, chloroplast membranes) may show distinct alterations in lipid composition. The subcellular localization of ADS2 (primarily ER, but also Golgi and plastids) suggests that multiple membrane systems may be affected .

  • Temperature-dependent effects: Since ADS2 is involved in cold stress response, lipid profile changes may be more pronounced under low-temperature conditions. Comparative analyses at different temperatures are essential .

  • Developmental stage: The severity of phenotypes in ads2 mutants increases with prolonged cold exposure and after reproductive transition, suggesting that lipid profile changes may vary with developmental stage .

  • Pathway interconnections: Alterations in one lipid class may affect others due to metabolic connections between different lipid biosynthesis pathways. For example, changes in MGDG and PG levels in ads2 mutants are accompanied by alterations in various phospholipids .

  • Compensatory mechanisms: Other desaturases may partially compensate for the loss of ADS2 function, potentially masking some effects on lipid profiles.

What are the key considerations when designing freezing tolerance experiments with ads2 mutants?

When designing freezing tolerance experiments with ads2 mutants, researchers should consider:

  • Acclimation protocols: Since ads2 mutants retain some capacity for cold acclimation, experiments should include both non-acclimated and acclimated plants to distinguish between constitutive and inducible freezing tolerance .

  • Temperature range: Based on previous studies, the critical temperature range for differentiating between wild-type and ads2 mutant survival is between -7°C and -12°C, with the temperature for 50% survival (LT50) being approximately -10.0°C for wild-type and -8.0°C for ads2 mutants .

  • Mutant alleles: Different ads2 mutant alleles (ads2-1, ads2-2, ads2-3, ads2-4) may exhibit varying degrees of freezing sensitivity, so multiple alleles should be tested .

  • Controls: Include appropriate controls such as wild-type plants and, if possible, mutants affected in other cold-responsive genes or other desaturases (e.g., fad5-1) for comparison .

  • Recovery assessment: Freezing damage should be assessed after a recovery period at normal growth temperatures, as some damage may not be immediately apparent.

How can quantitative trait loci (QTL) analysis be applied to study natural variation in ADS2 function?

QTL analysis can be a powerful approach to study natural variation in ADS2 function and its impact on lipid composition and cold tolerance. Based on related studies of fatty acid desaturases in Arabidopsis, the following strategies can be employed:

  • Population selection: Multiparent Advanced Generation Inter-Cross (MAGIC) recombinant inbred (RI) populations, such as that created by Kover et al. (2009), can be used to screen for QTL controlling fatty acid composition and cold tolerance .

  • Phenotyping: Measure relevant traits such as ω-7 fatty acid content, membrane lipid composition, cold acclimation capacity, and freezing tolerance in the RI population.

  • Genotyping: Use molecular markers to genotype the population and identify marker-trait associations.

  • QTL mapping: Perform statistical analyses to identify genomic regions (QTL) associated with variation in the traits of interest.

  • Candidate gene identification: Once QTL are identified, candidate genes within the QTL intervals can be prioritized based on their known functions. ADS2 or genes that interact with ADS2 might be identified as candidates .

  • Validation: Validate candidate genes through complementation studies, gene expression analysis, or by creating near-isogenic lines differing only at the QTL of interest.

What are the promising areas for future research on ADS2 and related desaturases?

Several promising directions for future research on ADS2 include:

  • Regulatory networks: Investigating the transcriptional and post-translational regulation of ADS2, particularly in response to cold stress. Identifying transcription factors and signaling pathways that control ADS2 expression could provide insights into cold stress response mechanisms.

  • Protein-protein interactions: Determining whether ADS2 interacts with other proteins, particularly other desaturases or enzymes involved in lipid metabolism, could reveal functional complexes important for membrane remodeling.

  • Evolutionary studies: Comparative analyses of ADS2 orthologs across plant species with varying cold tolerance could reveal evolutionary adaptations in desaturase function related to environmental adaptation.

  • Applied aspects: Exploring the potential for engineering enhanced cold tolerance in crops by modulating ADS2 expression or activity, particularly in species where cold sensitivity limits geographic distribution or growing season.

  • Lipid trafficking: Investigating how lipids modified by ADS2 are transported between different cellular compartments, given that ADS2 localizes to multiple organelles including the ER, Golgi, and plastids .

  • Metabolic engineering: Using ADS2 and related desaturases to produce specialized fatty acids for industrial or nutritional applications, building on their ability to produce ω-7 VLCFAs and other modified fatty acids .

How might advanced technologies enhance our understanding of ADS2 function?

Advanced technologies that could enhance our understanding of ADS2 function include:

  • CRISPR-Cas9 genome editing: Creating precise modifications in ADS2 and related genes to study specific protein domains or regulatory elements.

  • Lipidomics: High-throughput, comprehensive analyses of lipid species using advanced mass spectrometry techniques could provide detailed insights into the changes in lipid profiles caused by ADS2 mutation or overexpression.

  • Single-cell analysis: Techniques for analyzing gene expression and lipid composition at the single-cell level could reveal cell-type-specific functions of ADS2.

  • Cryo-electron microscopy: Structural studies of ADS2 and its interactions with membrane lipids could provide insights into its mechanism of action.

  • Synthetic biology approaches: Reconstituting lipid desaturation pathways in heterologous systems could allow detailed mechanistic studies of ADS2 function and its coordination with other enzymes.

  • Systems biology: Integrating transcriptomic, proteomic, and lipidomic data to model the role of ADS2 in plant cold stress response networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.