Recombinant Arabidopsis thaliana Delta-9 desaturase-like 2 protein (At1g06100)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana Delta-9 Desaturase-like 2 Protein (At1g06100)

Arabidopsis thaliana Delta-9 desaturase-like 2 protein (At1g06100) is a member of the acyl-coenzyme A (CoA) desaturase-like (ADS) gene family in Arabidopsis thaliana . This family comprises nine genes that encode fatty acid desaturase-like proteins .

Characteristics

  • Synonyms: At1g06100, T21E18.15, T21E18_12, Delta-9 desaturase-like 2 protein

  • Source: Produced in an in vitro E. coli expression system

  • Subcellular Location: Endoplasmic reticulum membrane; Multi-pass membrane protein

  • Protein Length: Full length protein, with the expression region spanning from 1-299

  • Function: Exhibits desaturase activity on very-long-chain fatty acid (VLCFA) substrates, introducing double bonds at the n-7 position relative to the methyl end of the molecule

Function and Activity

At1g06100, also referred to as AtADS1.3, demonstrates desaturase activity by introducing double bonds at the n-7 position on very-long-chain fatty acid (VLCFA) substrates . While only one member of the Arabidopsis thaliana acyl-coenzyme A (CoA) desaturase-like (ADS) gene family, fatty acid desaturase5 (AtADS3/FAD5, At3g15850), has a known biological function, research has shown that At1g06100 has previously undescribed desaturase activity .

Genetic and Expression Details

  • Gene Family: Belongs to the fatty acid desaturase type 1 family

  • Database Links: KEGG (ath:AT1G06100), STRING (3702.AT1G06100.1), UniGene (At.50644)

  • The Arabidopsis thaliana genome contains nine ADS Δ9 desaturase family members .

Role in Fatty Acid Metabolism

AtADS2 is involved in synthesizing the 24:1(n-9) and 26:1(n-9) components of seed lipids, sphingolipids, and membrane phospholipids like phosphatidylserine and phosphatidylethanolamine . Plants with deficient AtADS2 expression exhibit a near complete loss of phosphatidylethanolamine(42:4), phosphatidylserine(42:4), dihydroxy-monohexosylceramide(42:2)-2, trihydroxy-monohexosylceramide(42:2)-3, and trihydroxy-glycosylinositolphosphoceramide(42:2)-3, lipid species that contain the VLCFA 24:1(n-9), and trihydroxy-glycosylinositolphosphoceramide(44:2)-3, a lipid containing 26:1(n-9) . Acyl-CoA profiling of these plants showed a major reduction in 24:1-CoA and a slight reduction in 26:1-CoA . Overexpression of AtADS2 leads to a substantial increase in the percentage of glycerolipid and sphingolipids species containing 24:1 and a dramatic increase in the percentage of very-long-chain monounsaturated fatty acids in the acyl-CoA pool .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At1g06100; T21E18.15; T21E18_12; Delta-9 desaturase-like 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g06100
Target Protein Sequence
MSETTKDDGSSQKKSVRKEKRAYVLRKWTQFDVGRASTVGTVHLLCLLAPFNYKWEAFRF GIILAILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQF TDSDRDPHSPIEGFWFSHVLWIFDTDYIREKCGRRNNVMDLKQQWFYRFLKKTLVLHILA FWTLIYLWGGLPYLTWTVGFGGVIGYHGTWLVNSACHICGSQAWQTNDTSRNVWWLALLT MGESWHNNHHAFETSARHGLEWYQLDITWYLIWFFQALGLATNVKLPTDAQKRKMAIRR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G06100

STRING: 3702.AT1G06100.1

UniGene: At.50644

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.