Recombinant Arabidopsis thaliana Derlin-1 (DER1)

Shipped with Ice Packs
In Stock

Description

1.1. Protein Architecture

Derlin-1 is a multi-pass transmembrane protein with six transmembrane domains (TMDs) and conserved rhomboid-like motifs. Its sequence includes a cytoplasmic N-terminal His-tag for purification and a luminal C-terminal region critical for substrate recognition. Key structural features include:

  • WR Motif: A conserved tryptophan-arginine motif in Loop 1 (L1), essential for substrate binding and retrotranslocation .

  • GxxxG Motif: A glycine-rich motif in TMD6, implicated in membrane thinning and retrotranslocation efficiency .

FeatureDescription
Expression SystemE. coli (in vitro system)
TagN-terminal 10×His-tag
Molecular Weight~30–35 kDa (calculated from 266 residues)
LocalizationEndoplasmic reticulum membrane

1.2. Functional Role in ERAD

DER1 facilitates retrotranslocation of misfolded luminal proteins from the ER to the cytosol for proteasomal degradation. Key interactions include:

  • HRD1: A ubiquitin ligase that ubiquitinates retrotranslocated substrates .

  • CDC48: An AAA-ATPase that couples ATP hydrolysis to retrotranslocation .

  • VIMP/SELS: Adaptor proteins linking DER1 to the p97/VCP complex .

Mechanistic Insights:

  • Membrane Thinning: DER1’s TMD2 facilitates lipid bilayer disruption, enabling substrate extraction .

  • Substrate Recognition: The luminal C-terminal domain binds misfolded proteins, while the cytoplasmic N-terminus recruits HRD1 .

2.1. Expression Patterns and Stress Responses

  • Tissue-Specific Expression: Highest in leaves, with detectable levels in roots, stems, and seeds .

  • ER Stress Induction: DER1 mRNA and protein levels surge under tunicamycin treatment or other stressors, aligning with unfolded protein response (UPR) activation .

2.2. Genetic and Functional Studies

StudyKey Findings
OsDER1 in Rice Suppression causes floury seeds and ER stress hypersensitivity; interacts with OsHRD1 and OsCDC48.
Conserved Motifs Loop 1 (L1) mutants impair substrate binding; TMD2 mutations disrupt lipid thinning.
N-Terminal Acetylation Essential for Der1 activity in yeast; acetylation prevents premature degradation.

2.3. Comparative Analysis with Homologs

OrganismHomologKey Difference
YeastDER1Mediates degradation of luminal substrates .
HumansDerlin-1Forms tetrameric channels for retrotranslocation .
RiceOsDER1ER stress-sensitive; interacts with SPP-like proteins .

3.2. Plant Stress Tolerance

  • Crop Improvement: Overexpression of DER1 homologs may enhance protein folding capacity under abiotic stress (e.g., drought, heat) .

  • Seed Quality: Suppression of DER1 correlates with floury, shrunken seeds in rice, suggesting a role in post-translational quality control .

3.3. Disease Modeling

  • Amyotrophic Lateral Sclerosis (ALS): While not directly linked to Arabidopsis DER1, mammalian Derlin-1’s interaction with SOD1 mutants highlights its role in neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Please note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipment, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DER1; At4g29330; F17A13.150; Derlin-1; AtDerlin1-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
DER1
Target Protein Sequence
MSSPGEFYNSLPPITKAYGTLCFFTTVATQLGLVAPVHIALIPELVLKQFQIWRLITNLF FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFL GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH LYYFLTVLHPLATGKNYLKTPKWVNKIVARWRIGAPVASVRQAGGVGAAGPGAGGGVGGG GAYSSARAPPESSNTAFRGRSYRLTD
Uniprot No.

Target Background

Function
Derlin-1 (DER1) may be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.
Database Links

KEGG: ath:AT4G29330

STRING: 3702.AT4G29330.1

UniGene: At.27188

Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana Derlin-1 and what is its role in plant cells?

Arabidopsis thaliana Derlin-1 (DER1) is a protein implicated in endoplasmic reticulum-associated degradation (ERAD), a cellular process that directs misfolded proteins from the ER lumen and membrane to degradation machinery in the cytosol. DER1 is expressed at low levels throughout the plant but appears more prevalent in tissues with high secretory protein accumulation, including developing endosperm cells. Notably, DER1 expression increases during ER stress, suggesting its importance in the cellular stress response pathway. The protein localizes to the membrane fraction of microsomes and can be found primarily associated with ER-derived protein bodies in plant cells .

How is recombinant Arabidopsis thaliana DER1 typically produced for research applications?

Recombinant Arabidopsis thaliana DER1 is commonly produced through heterologous expression in E. coli systems. The full-length protein (1-266 amino acids) is expressed with an N-terminal His-tag to facilitate purification. The resultant protein is typically isolated through affinity chromatography, dialyzed, and supplied as a lyophilized powder. For research applications, reconstitution in deionized sterile water to 0.1-1.0 mg/mL is recommended, with addition of glycerol (5-50% final concentration) for long-term storage at -20°C or -80°C to prevent degradation through freeze-thaw cycles .

How does DER1 function within the ERAD machinery in plant cells compared to yeast and mammalian systems?

The function of DER1 in ERAD appears to be evolutionarily conserved across eukaryotes, though with notable differences in structural organization. In plants, DER1 acts as a component of the ERAD system involved in recognizing and translocating misfolded proteins from the ER for cytosolic degradation. Complementation studies have shown that Derlin genes from plants (like maize Derlins) can functionally substitute for yeast Der1 deletion mutants, confirming functional conservation .

Methodologically, researchers investigating plant-specific ERAD functions should consider employing both heterologous expression systems and in planta studies to fully characterize Arabidopsis DER1's interaction network within the broader ERAD machinery.

What is the relationship between Arabidopsis DER1 expression and ER stress response pathways?

Arabidopsis DER1 expression significantly increases during ER stress conditions, with differential expression patterns observed among Derlin family members. Research indicates that during ER stress, Arabidopsis DER1 plays a crucial role in the plant's adaptive response by facilitating the clearance of misfolded proteins that accumulate in the ER lumen and membrane.

To experimentally investigate this relationship, researchers can employ the following methodological approach:

  • Induce ER stress using chemical agents (tunicamycin, DTT) or genetic manipulation

  • Measure DER1 transcript levels through qRT-PCR and protein levels via Western blotting

  • Correlate DER1 expression with established ER stress markers

  • Examine phenotypic outcomes in DER1 knockout or overexpression lines under ER stress conditions

  • Perform RNA-seq analysis to map DER1 within the broader transcriptional network activated during ER stress

This approach allows for a comprehensive understanding of how DER1 integrates with other stress-responsive factors to maintain ER homeostasis .

How do post-translational modifications affect Arabidopsis DER1 function and stability?

While direct evidence of post-translational modifications (PTMs) for Arabidopsis DER1 is limited in the current literature, research on homologous proteins suggests several potential PTMs that may regulate DER1 function:

  • Phosphorylation: Potential phosphorylation sites may regulate DER1's interaction with other ERAD components, its oligomerization, or channel opening/closing dynamics

  • Ubiquitination: As a protein involved in the degradation machinery, DER1 itself may be regulated through ubiquitination

  • Glycosylation: Possible N-linked glycosylation may influence protein stability or localization

To investigate these PTMs, researchers should consider:

  • Phosphoproteomic analysis of DER1 under various stress conditions

  • Site-directed mutagenesis of predicted PTM sites to evaluate functional impacts

  • Co-immunoprecipitation studies with PTM-specific antibodies

  • Mass spectrometry analysis of purified DER1 to identify PTM patterns

Understanding these modifications will provide insight into how plants dynamically regulate their ERAD machinery in response to changing cellular conditions .

What are the optimal conditions for expressing and purifying recombinant Arabidopsis DER1?

For optimal expression and purification of recombinant Arabidopsis DER1, researchers should consider the following methodological parameters:

Expression System Selection:

  • E. coli BL21(DE3) is the most common and cost-effective system

  • Consider Rosetta or Origami strains for enhancing proper folding of the protein

  • For membrane proteins like DER1, C41(DE3) or C43(DE3) strains often yield better results

Expression Conditions Optimization:

  • Induction with 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

  • Lower temperature expression (16-20°C) for 16-18 hours enhances proper folding

  • Addition of 0.5-1% glucose can reduce leaky expression

Purification Protocol:

  • Cell lysis using appropriate detergents (e.g., n-dodecyl β-D-maltoside)

  • Affinity chromatography using Ni-NTA resin for His-tagged DER1

  • Size exclusion chromatography to separate monomeric and oligomeric forms

  • Optional ion exchange chromatography for further purification

Storage Conditions:

  • Store in Tris/PBS-based buffer (pH 8.0) with 6% trehalose

  • Aliquot and store at -80°C to avoid freeze-thaw cycles

  • For working solutions, maintain at 4°C for up to one week

This methodological approach typically yields >90% pure protein suitable for biochemical and structural studies .

What experimental approaches can be used to study DER1 interactions with ERAD substrates?

To investigate DER1 interactions with ERAD substrates, researchers can employ several complementary methodological approaches:

In Vivo Approaches:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of DER1 and potential substrate proteins, followed by pull-down assays to detect physical interactions.

  • Bimolecular Fluorescence Complementation (BiFC): Split fluorescent proteins fused to DER1 and substrate candidates can visualize interactions in planta.

  • Förster Resonance Energy Transfer (FRET): Using fluorescently labeled DER1 and substrates to detect proximity in living cells.

In Vitro Approaches:

  • Reconstitution Assays: Purify recombinant DER1 and incorporate it into liposomes or nanodiscs to test substrate binding.

  • Surface Plasmon Resonance (SPR): Measure binding kinetics between immobilized DER1 and flowing substrate proteins.

  • Crosslinking Mass Spectrometry: Identify interaction interfaces between DER1 and substrates.

Genetic Approaches:

  • Yeast Two-Hybrid: Modified membrane yeast two-hybrid systems can detect DER1-substrate interactions.

  • Suppressor Screens: Identify genetic modifiers that enhance or suppress DER1-mediated degradation of model substrates.

For a comprehensive understanding, researchers should combine multiple approaches, as each has distinct advantages and limitations when studying membrane protein interactions like those involving DER1 .

How can researchers generate and validate DER1 mutants for functional studies?

Generating and validating functional DER1 mutants requires a systematic approach combining molecular techniques and functional assays:

Generation of DER1 Mutants:

  • CRISPR/Cas9 Gene Editing:

    • Design sgRNAs targeting DER1 coding sequence

    • Screen for mutations using sequencing

    • Confirm homozygosity through segregation analysis

  • RNAi and Artificial microRNA:

    • Design constructs targeting unique regions of DER1

    • Generate stable transgenic lines with inducible knockdown

    • Quantify silencing efficiency via qRT-PCR and Western blotting

  • Site-Directed Mutagenesis:

    • Create point mutations in conserved residues

    • Focus on predicted transmembrane domains and protein interaction sites

    • Engineer dominant-negative variants (similar to those used in Derlin-1 studies)

Validation Approaches:

  • Functional Complementation:

    • Express mutant variants in der1 knockout backgrounds

    • Assess restoration of wild-type phenotypes

    • Test complementation in yeast der1Δ mutants

  • Substrate Degradation Assays:

    • Monitor degradation kinetics of known ERAD substrates

    • Use pulse-chase experiments to track protein stability

    • Employ fluorescent timer proteins to visualize degradation in real-time

  • Stress Response Evaluation:

    • Challenge mutant lines with ER stress inducers

    • Measure activation of unfolded protein response markers

    • Assess plant growth and development under stress conditions

Mutation TypeTarget RegionExpected EffectValidation Method
Transmembrane domainResidues 35-55Disrupt channel formationCo-IP, microscopy
C-terminal truncationAfter residue 230Alter protein interactionsY2H, BiFC
Conserved motifsGVSLVFML sequencePrevent substrate recognitionDegradation assays
Phosphorylation sitesSer/Thr residuesModify regulationPhosphomimetic mutants

This comprehensive approach ensures that mutant phenotypes can be directly attributed to specific functional alterations in the DER1 protein .

What structural features enable DER1 to function in protein retrotranslocation?

The structural features that enable DER1 to participate in protein retrotranslocation can be inferred from studies of homologous proteins, particularly human Derlin-1. Key structural elements likely include:

  • Transmembrane Organization: Arabidopsis DER1 contains multiple predicted transmembrane domains that likely form a channel-like structure across the ER membrane. These hydrophobic segments are arranged to create a protected conduit for translocating misfolded proteins from the ER lumen to the cytosol.

  • Oligomerization Interfaces: Based on human Derlin-1 studies, DER1 may form homotetramers that encircle a central tunnel approximately 12-15 Å in diameter—large enough to accommodate an α-helix. This oligomerization is critical for creating a functional retrotranslocation channel.

  • Lateral Gate Structure: Similar to human Derlin-1, Arabidopsis DER1 likely features a lateral gate within the membrane, providing access for transmembrane segments of ERAD substrates to enter the central channel without completely unfolding.

  • Cytosolic and Luminal Loops: These regions mediate interactions with other ERAD components, including recognition factors, ubiquitination machinery, and extraction complexes that provide the mechanical force for substrate retrotranslocation.

To experimentally validate these structural features in Arabidopsis DER1, researchers could employ:

  • Cysteine scanning mutagenesis to map accessible residues

  • Crosslinking approaches to identify proximity relationships

  • Cryo-EM studies of purified DER1 complexes to determine channel architecture

  • Molecular dynamics simulations to predict substrate movement through the channel

These approaches would significantly advance our understanding of how plant DER1 facilitates the critical ERAD step of protein retrotranslocation .

How does DER1 coordinate with other components of the plant ERAD machinery?

DER1 functions as part of a multiprotein complex within the plant ERAD machinery, coordinating substrate recognition, retrotranslocation, and degradation through several key interactions:

Recognition Complex Interactions:

  • DER1 likely interacts with ER-resident chaperones like BiP and protein disulfide isomerases (PDIs) that recognize misfolded proteins

  • These interactions may be mediated through DER1's luminal loops, which can bind to exposed hydrophobic regions on misfolded substrates or chaperone-substrate complexes

  • Studies on homologous proteins show that Derlin-1 associates with PDI, suggesting a similar interaction may occur with Arabidopsis DER1

Membrane Complex Formation:

  • DER1 may form complexes with other membrane-bound ERAD components, creating a specialized retrotranslocation site

  • In yeast and mammals, Derlins associate with ubiquitin ligases and their adaptors

  • Plant-specific interactions may include associations with Hrd1-like E3 ligases and plant-specific membrane proteins

Cytosolic Extraction Machinery:

  • Once substrates begin retrotranslocation through the DER1 channel, cytosolic components including Cdc48/p97 (plant homolog) likely bind to extract the protein

  • DER1's cytosolic domains may contain binding sites for these extraction factors

  • Ubiquitination of substrates during retrotranslocation may be coordinated through DER1's positioning of the substrate

Regulatory Interactions:

  • DER1 expression and activity appear to be upregulated during ER stress

  • This regulation may involve interactions with components of the unfolded protein response (UPR) signaling pathway

Methodologically, researchers investigating these interactions should employ:

  • Proximity labeling techniques (BioID, APEX) to identify the DER1 interactome in planta

  • Co-immunoprecipitation followed by mass spectrometry to identify stable interaction partners

  • Genetic studies using mutants of putative interacting partners to establish functional relationships

  • In vitro reconstitution of minimal ERAD components to define sufficient interaction partners

Understanding these coordinated interactions will provide insight into how plants have adapted the conserved ERAD machinery to their specific cellular requirements .

What is the role of DER1 in substrate selectivity during ERAD?

The role of DER1 in substrate selectivity during ERAD remains an active area of investigation, with several key aspects to consider:

Substrate Recognition Mechanisms:

  • DER1 may recognize specific structural features or hydrophobic patches exposed in misfolded proteins

  • Studies with homologous proteins suggest DER1 could directly bind to unfolded or partially folded substrates

  • DER1 may also interact with substrate-chaperone complexes rather than substrates directly

Substrate Classes:

  • Evidence from yeast and mammalian systems indicates that Derlins may exhibit preference for different ERAD substrate classes:

    • ERAD-L (lumenal substrates)

    • ERAD-M (membrane substrates)

    • ERAD-C (cytosolic domain-containing substrates)

  • Arabidopsis DER1 may show similar specialization, potentially focusing on specific subsets of misfolded proteins

Structural Determinants of Selectivity:

  • The dimensions and chemical properties of the DER1 channel likely impose constraints on which substrates can be translocated

  • The lateral gate structure observed in human Derlin-1 may allow for selective entry of transmembrane segments

  • Plant-specific adaptations in DER1 structure may reflect unique substrate requirements in plant cells

Experimental Approaches to Study Selectivity:

  • Identify natural DER1 substrates through:

    • Proteomics comparing wild-type and der1 mutant cells under ER stress

    • Proximity labeling of proteins that associate with DER1

    • Stable isotope labeling to track degradation kinetics of potential substrates

  • Analyze substrate properties using:

    • Bioinformatic analysis of identified substrates for common motifs

    • In vitro binding assays with purified DER1 and model substrates

    • Competition assays between different substrate classes

  • Engineer model substrates with:

    • Varying degrees of misfolding

    • Different topological arrangements

    • Fusion to fluorescent reporters for real-time degradation monitoring

Understanding substrate selectivity will provide critical insights into how plants maintain ER protein homeostasis through quality control mechanisms mediated by DER1 .

How conserved is DER1 function across plant species compared to yeast and mammalian homologs?

The function of DER1 appears to be highly conserved across eukaryotes, with both similarities and notable differences across plant species, yeast, and mammals:

Functional Conservation:

  • Complementation studies demonstrate that plant Derlins (e.g., from maize) can functionally substitute for yeast Der1 deletion mutants, indicating fundamental conservation of core functions

  • The essential role in ERAD and retrotranslocation appears consistent across kingdoms

  • All Derlins appear to participate in multiprotein complexes involved in protein quality control

Structural Variations:

  • Human Derlin-1 forms homotetramers creating a central channel

  • Yeast Der1 forms a semichannel in conjunction with another protein

  • Plant DER1 structure has not been fully characterized, but likely incorporates elements from both arrangements

Evolutionary Adaptations:

  • Plants typically possess multiple DER1 homologs with potentially specialized functions

  • Plant-specific ERAD substrates may have driven unique adaptations in DER1 structure and function

  • Stress response patterns differ, with plant DER1 showing strong upregulation during specific developmental stages and environmental stresses

Comparative Methodological Approaches:

Analysis TypeMethodologyKey Insights
Sequence AnalysisMultiple sequence alignment of DER1 homologsIdentification of conserved domains and plant-specific sequence features
Phylogenetic AnalysisMaximum likelihood trees of Derlin proteinsEvolutionary relationships and potential functional divergence
Heterologous ExpressionCross-species complementation assaysFunctional conservation and species-specific requirements
Interactome ComparisonAffinity purification-mass spectrometrySpecies-specific interacting partners

This comparative analysis reveals that while the fundamental mechanism of DER1 function in ERAD is conserved, plants have evolved specific adaptations in DER1 structure, regulation, and interaction networks to meet their unique cellular requirements .

How do different Arabidopsis DER1 isoforms vary in their expression patterns and functions?

Arabidopsis possesses multiple DER1 homologs that exhibit distinct expression patterns and potentially specialized functions within the plant ERAD system:

Expression Pattern Differences:

  • Different DER1 isoforms show tissue-specific expression patterns

  • Expression levels vary during development, with some isoforms prevalent in tissues with high secretory activity

  • Stress responsiveness differs among isoforms, with some showing stronger upregulation during specific types of ER stress

Functional Specialization:

  • Different DER1 isoforms may preferentially handle distinct classes of ERAD substrates

  • Some isoforms may have evolved specialized roles in plant-specific processes

  • Potential redundancy exists among isoforms, complicating single-gene knockout studies

Regulatory Variation:

  • Transcriptional control mechanisms differ among DER1 isoforms

  • Post-translational modifications may differentially regulate specific variants

  • Protein stability and turnover rates may vary among isoforms

Methodological Approaches for Studying Isoform Differences:

  • Expression Analysis:

    • RNA-seq data across tissues, developmental stages, and stress conditions

    • Promoter-reporter fusions to visualize expression patterns in planta

    • Isoform-specific antibodies for protein-level detection

  • Genetic Studies:

    • Single and combined knockout/knockdown lines of different isoforms

    • Complementation with specific isoforms to rescue phenotypes

    • Overexpression studies to identify dominant effects

  • Biochemical Characterization:

    • Substrate specificity assays for different isoforms

    • Interaction partner identification through IP-MS for each variant

    • Channel activity measurements in reconstituted systems

Understanding these isoform-specific differences will provide insight into how plants have evolved a sophisticated ERAD system with potentially specialized components to handle diverse misfolded proteins in different cellular contexts .

What can we learn about DER1 function from studies of its interaction with pathogen virulence factors?

Studies of DER1 interactions with pathogen virulence factors provide valuable insights into both DER1 function and host-pathogen dynamics:

Cholera Toxin (CT) Interaction Model:

  • Research on mammalian Derlin-1 has shown that it facilitates the retro-translocation of Cholera Toxin (CT)

  • CT B subunit (CTB) associates with Derlin-1 and promotes the unfolding and transport of the catalytic A1 subunit

  • Dominant-negative Derlin-1 decreases the ER-to-cytosol transport of the A1 peptide

  • This system provides a model for understanding how DER1 might handle substrate retrotranslocation

Applications to Plant DER1:

  • Plant pathogens may similarly exploit the DER1 retrotranslocation channel

  • Plant viruses often depend on ER functions for replication and movement

  • Bacterial effectors may target or utilize ERAD machinery to establish infection

Experimental Approaches for Plant Systems:

  • Identification of Pathogen Factors Interacting with DER1:

    • Yeast two-hybrid screens using plant DER1 as bait against pathogen protein libraries

    • Co-immunoprecipitation from infected plant tissues

    • BiFC/FRET studies in planta during infection

  • Functional Assessment:

    • Determine if DER1 mutants show altered susceptibility to specific pathogens

    • Test if pathogen factors modulate DER1 channel activity

    • Investigate if pathogens specifically upregulate or downregulate DER1 expression

  • Mechanistic Studies:

    • Examine if pathogen proteins are retrotranslocated via DER1

    • Determine if pathogens use DER1 to deliver effectors to the cytosol

    • Investigate if DER1-dependent ERAD is manipulated to promote pathogen survival

Insights from these studies could reveal:

  • Novel substrate recognition mechanisms employed by DER1

  • Structural requirements for protein translocation through the DER1 channel

  • Regulatory mechanisms controlling DER1 activity

  • Potential targets for engineering disease resistance by modifying DER1 function

This research direction represents a valuable intersection of plant cell biology, ERAD mechanisms, and plant-pathogen interactions .

What are common challenges in working with recombinant DER1 and how can they be overcome?

Working with recombinant DER1 presents several technical challenges due to its nature as an integral membrane protein. Below are common issues researchers encounter and methodological approaches to address them:

Challenge 1: Low Expression Yields

  • Problem: Membrane proteins often express poorly in heterologous systems

  • Solutions:

    • Optimize codon usage for expression host

    • Use specialized E. coli strains (C41/C43, Rosetta)

    • Lower induction temperature (16-18°C)

    • Consider fusion tags that enhance solubility (MBP, SUMO)

    • Test expression in alternate systems (insect cells, yeast)

Challenge 2: Protein Aggregation

  • Problem: DER1 tends to aggregate during extraction and purification

  • Solutions:

    • Screen detergents systematically (DDM, LDAO, Digitonin)

    • Include stabilizing agents (glycerol, specific lipids)

    • Use mild solubilization conditions

    • Consider amphipols or nanodiscs for final formulation

    • Implement on-column refolding during purification

Challenge 3: Maintaining Functional State

  • Problem: Purified DER1 may lose functional activity

  • Solutions:

    • Verify oligomeric state by SEC-MALS

    • Test channel activity in liposome reconstitution assays

    • Include co-factors that may stabilize active conformation

    • Optimize buffer composition (pH, salt, additives)

    • Minimize freeze-thaw cycles (aliquot and store at -80°C)

Challenge 4: Structural Analysis Difficulties

  • Problem: Membrane proteins are challenging for structural studies

  • Solutions:

    • Consider cryo-EM for structure determination

    • Use cross-linking mass spectrometry to identify domains

    • Employ hydrogen-deuterium exchange mass spectrometry

    • Consider truncation constructs focusing on specific domains

Troubleshooting Table for Recombinant DER1 Work:

IssuePossible CausesTroubleshooting Approach
No visible expressionToxicity, protein degradationUse tighter promoter control, protease-deficient strains
Protein in inclusion bodiesImproper folding, overexpressionLower induction temperature, reduce IPTG concentration
Poor affinity purificationTag inaccessibilityMove tag position, use alternative tags, optimize binding conditions
Loss of activity after purificationDetergent effects, improper refoldingTest native membrane extraction, gentler purification protocols
Heterogeneous oligomeric statesSample preparation issuesOptimize buffer conditions, include specific lipids

These methodological strategies can significantly improve the success rate when working with this challenging but important membrane protein .

How can researchers optimize DER1 functional assays for different experimental goals?

Optimizing DER1 functional assays requires tailored approaches based on specific experimental goals. Here are methodological considerations for different research objectives:

Goal 1: Measuring DER1-Mediated Protein Retrotranslocation

  • In Vivo Approaches:

    • Develop split reporter systems where substrate translocation activates a detectable signal

    • Use protease protection assays to monitor movement from ER lumen to cytosol

    • Engineer ERAD substrates with environment-sensitive fluorophores

  • In Vitro Approaches:

    • Reconstitute DER1 in liposomes with fluorescently labeled substrates

    • Measure substrate translocation using proteoliposomes with entrapped proteases

    • Develop electrophysiological assays to measure channel activity

Goal 2: Assessing DER1 Substrate Specificity

  • Competition Assays:

    • Compare degradation kinetics of different substrates in the presence of limiting DER1

    • Use fluorescently tagged model substrates with different structural features

  • Binding Studies:

    • Employ microscale thermophoresis to measure binding affinities

    • Develop proximity labeling strategies to identify preferential substrates

    • Use hydrogen-deuterium exchange mass spectrometry to map binding interfaces

Goal 3: Analyzing DER1 Protein Interactions

  • Binary Interaction Detection:

    • Optimize split-ubiquitin membrane yeast two-hybrid for membrane protein interactions

    • Develop FRET/BRET pairs suitable for ER membrane environment

  • Complex Assembly Analysis:

    • Use crosslinking coupled with mass spectrometry (XL-MS)

    • Employ blue native PAGE to preserve native complexes

    • Conduct glycerol gradient centrifugation to separate complexes by size

Goal 4: Structural Conformational Changes

  • Dynamic Measurements:

    • Implement single-molecule FRET to detect conformational states

    • Use site-specific labeling with environment-sensitive probes

    • Develop cysteine accessibility assays to map channel openings

Optimization Parameters for Different Assays:

Assay TypeCritical ParametersValidation Controls
RetrotranslocationTemperature, ATP concentration, cytosolic extract compositionKnown ERAD substrates, ATP depletion
Substrate bindingDetergent/lipid composition, salt concentrationBinding-deficient mutants, competition with known ligands
Complex formationCrosslinker type/concentration, solubilization conditionsIndividual component controls, size standards
Channel activityMembrane composition, pH gradient, potential differenceChannel blockers, conductance standards

These methodological considerations ensure that functional assays are properly optimized for the specific research question being addressed, leading to more reliable and meaningful data on DER1 function .

What are the key considerations for designing DER1 knockout and overexpression studies in Arabidopsis?

Designing effective DER1 knockout and overexpression studies in Arabidopsis requires careful consideration of several methodological aspects to ensure meaningful results:

Knockout Strategy Considerations:

  • Genetic Redundancy Management:

    • Arabidopsis contains multiple DER1 homologs that may have partially redundant functions

    • Generate single, double, and higher-order mutants to address redundancy

    • Consider CRISPR/Cas9 multiplex targeting for simultaneous knockout of multiple genes

  • Knockout Verification Protocol:

    • Confirm gene disruption at DNA level (sequencing)

    • Verify absence of transcript (RT-PCR, RNA-seq)

    • Validate protein elimination (Western blotting)

    • Consider using epitope-tagged genomic complementation to verify antibody specificity

  • Phenotypic Analysis Framework:

    • Examine growth under normal and ER stress conditions

    • Assess developmental stages with high secretory activity

    • Implement biochemical assays for ERAD substrate accumulation

    • Use electron microscopy to examine ER morphology

Overexpression Strategy Considerations:

  • Expression System Selection:

    • Choose between constitutive (35S) vs. inducible (estradiol, heat shock) promoters

    • Consider tissue-specific promoters for localized effects

    • Utilize native promoter with genomic context for physiological expression

  • Protein Tag Selection:

    • Select small epitope tags (HA, FLAG) to minimize functional interference

    • Consider fluorescent protein fusions for localization studies

    • Place tags at positions least likely to disrupt function based on structural predictions

    • Generate both N- and C-terminal tagged versions to compare functionality

  • Expression Level Control:

    • Screen multiple independent lines for varying expression levels

    • Establish correlation between expression level and phenotypic effects

    • Include wild-type controls in the same genetic background

Experimental Design Table:

Study TypeKey Design ElementsPotential PitfallsMitigation Strategies
Single gene knockoutT-DNA insertion or CRISPR/Cas9 editingGenetic compensationRNA-seq to identify upregulated paralogs
Multiple gene knockoutHigher-order mutants, CRISPR multiplexEmbryo lethalityInducible CRISPR or tissue-specific knockouts
Constitutive overexpression35S promoter, selectable markerGrowth defects, silencingScreen multiple lines, verify stable expression
Inducible overexpressionXVE/GR/heat shock systemsLeaky expression, incomplete inductionOptimize inducer concentration, include uninduced controls
Complementation studiesNative promoter, genomic contextTrans effects from insertion siteMultiple independent lines, site-directed integration

Phenotypic Evaluation Considerations:

  • Include substrate accumulation assays (model ERAD substrates)

  • Measure ER stress markers (BiP, PDI levels)

  • Assess plant growth under normal and stress conditions

  • Examine specific developmental stages with high secretory demands

This comprehensive approach ensures that genetic manipulation studies provide reliable insights into DER1 function while addressing potential complications arising from genetic redundancy and expression artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.