Recombinant Arabidopsis thaliana Diacylglycerol kinase 1 (DGK1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DGK1; At5g07920; F13G24.120; MXM12.16; Diacylglycerol kinase 1; AtDGK1; DAG kinase 1; Diglyceride kinase 1; DGK 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-728
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
DGK1
Target Protein Sequence
MDDDGELGMFFPSWTSKNPIDTVESRGLMFSCFVAALVGILTIAYTAFQWRRNINLSWTK AIARSKKNPKARHKVPVAPHSWELDPIARAKNLNCCVCLKSMSPSQAIVASESFFHRCTI CGAAAHFNCSSSAPKDCKCVSMVGFEHVVHQWAVRWTEGADQTDDSSFCSYCDESCSSSF LGGSPIWCCLWCQRLVHVDCHSNMSNETGDICDLGPLRRLILCPLYVKELTRNPSGGFLS SITHGANELASTALASIRIQSKKYKQTNETSADTGNSGSNCDESTESTADTGPTVNGAHA VLENSISVMNGDSSNGDSDSNGKLEKKPSVKRTGSFGQKEYHALRSKLKYELADLPSDAR PLLVFINKKSGAQRGDSLRQRLHLHLNPVQVFELSSVQGPEVGLFLFRKVPHFRVLVCGG DGTAGWVLDAIEKQNFISPPAVAILPAGTGNDLSRVLNWGGGLGSVERQGGLSTVLQNIE HAAVTVLDRWKVSILNQQGKQLQPPKYMNNYIGVGCDAKVALEIHNLREENPERFYSQFM NKVLYAREGARSIMDRTFEDFPWQVRVEVDGVDIEVPEDAEGILVANIGSYMGGVDLWQN EDETYENFDPQSMHDKIVEVVSISGTWHLGKLQVGLSRARRLAQGSAVKIQLCAPLPVQI DGEPWNQQPCTLTISHHGQAFMLKRAAEEPLGHAAAIITDVLENAETNQVINASQKRTLL QEMALRLT
Uniprot No.

Target Background

Function
This recombinant Arabidopsis thaliana Diacylglycerol kinase 1 (DGK1) phosphorylates the second messenger diacylglycerol (DAG) to produce phosphatidic acid (PA), another crucial signaling molecule. PA is essential for plant development and responses to abiotic stress and pathogen attack. DGK1 may also be involved in PA accumulation during cold stress.
Gene References Into Functions
  1. The Arabidopsis thaliana DGK1 and DGK2 isoforms (cluster I) possess N-terminal hydrophobic segments that target them to endoplasmic reticulum membranes. PMID: 18466768
Database Links

KEGG: ath:AT5G07920

STRING: 3702.AT5G07920.1

UniGene: At.260

Protein Families
Eukaryotic diacylglycerol kinase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, shoots, and leaves.

Q&A

What is Arabidopsis thaliana Diacylglycerol Kinase 1 (AtDGK1) and how is it classified among plant DGKs?

AtDGK1 is a member of the diacylglycerol kinase family in Arabidopsis thaliana that catalyzes the phosphorylation of diacylglycerol (DAG) to produce phosphatidic acid (PA). Phylogenetic analyses of plant DGKs have revealed that they fall into three distinct clusters, with AtDGK1 belonging to Cluster I along with other isoforms such as AtDGK2, BrDGK1, BrDGK2, and several DGKs from other plant species. This classification is based on sequence similarities and conserved domains, which has been consistently confirmed by multiple phylogenetic studies . The clustering of DGK isoforms provides insights into their evolutionary relationships and potentially shared functional characteristics, helping researchers understand the broader context of AtDGK1's role within the plant DGK family.

How does AtDGK1 differ structurally and functionally from other Arabidopsis DGK isoforms?

AtDGK1 possesses distinctive structural features compared to other Arabidopsis DGK isoforms. While all plant DGKs contain catalytic domains, AtDGK1 has unique regulatory domains that influence its subcellular localization and activity. Unlike AtDGK2 and AtDGK7, which have been demonstrated to be catalytically active in vitro, AtDGK1 enzyme was not found to be active in vitro in earlier studies by Katagiri et al. (2001) . This functional distinction suggests specific activation requirements or post-translational modifications necessary for AtDGK1 activity.

The tissue expression patterns also differ significantly among Arabidopsis DGK isoforms. While AtDGK1 is predominantly expressed in roots, shoots, and leaves, other isoforms like AtDGK2 show expression in the whole plant except stems, and AtDGK4 exhibits high expression specifically in stamens . These differences in expression patterns suggest specialized roles for each DGK isoform in different tissues and developmental processes.

What are the key physiological roles of DGK1 in Arabidopsis thaliana?

AtDGK1 plays crucial roles in lipid signaling pathways that mediate various physiological processes in Arabidopsis thaliana. Through its enzymatic function of converting DAG to PA, AtDGK1 contributes to maintaining appropriate levels of these two important signaling lipids. While specific functions of AtDGK1 have been challenging to characterize due to potential redundancy with other DGK isoforms, research suggests its involvement in membrane lipid homeostasis and stress responses.

What is the tissue-specific expression pattern of AtDGK1 and how can it be experimentally determined?

AtDGK1 exhibits a specific expression pattern, being mainly expressed in roots, shoots, and leaves of Arabidopsis thaliana . To experimentally determine the tissue-specific expression of AtDGK1, researchers can employ several complementary approaches:

  • Transcriptomic Analysis: Using databases like Genevestigator to analyze publicly available microarray or RNA-seq data across different tissues. This bioinformatics approach provides a comprehensive overview of expression patterns under various conditions and developmental stages .

  • Quantitative RT-PCR (qRT-PCR): This technique allows precise quantification of AtDGK1 mRNA levels in different tissues. For accurate results, researchers should:

    • Use gene-specific primers designed to distinguish AtDGK1 from other DGK isoforms

    • Include appropriate reference genes for normalization

    • Extract RNA from well-defined tissue samples at specific developmental stages

  • Promoter-Reporter Systems: Creating transgenic Arabidopsis lines with the AtDGK1 promoter driving the expression of a reporter gene (e.g., GUS or GFP) to visualize expression patterns directly in tissues.

  • In Situ Hybridization: This technique allows detection of AtDGK1 mRNA directly in tissue sections, providing cellular resolution of expression patterns.

For comparative analysis, it's valuable to examine expression patterns of multiple DGK isoforms simultaneously, as studies have shown distinct expression profiles among DGK family members across different tissues and developmental stages .

How does post-translational modification affect AtDGK1 activity?

Post-translational modifications likely play crucial roles in regulating AtDGK1 activity. While the provided search results don't contain specific information about AtDGK1 post-translational modifications, insights can be drawn from studies on other DGK isoforms and homologs:

  • Phosphorylation: In yeast, Dgk1 is phosphorylated by Casein Kinase II, which stimulates its DAG kinase activity . The phosphorylation causes a characteristic mobility shift in SDS-PAGE, with the phosphorylated form migrating more slowly . Similar regulatory mechanisms might exist for plant DGKs including AtDGK1. Experimental approaches to investigate phosphorylation include:

    • Phosphatase treatment followed by activity assays to determine if dephosphorylation affects activity

    • Mass spectrometry to identify specific phosphorylation sites

    • Site-directed mutagenesis of potential phosphorylation sites to assess their functional significance

  • Calcium/Calmodulin Regulation: Some plant DGKs show calcium/calmodulin-dependent regulation. For instance, tomato LeDGK1 associates with membranes via a calcium/calmodulin-independent mechanism . Determining whether AtDGK1 is regulated by calcium or calmodulin would involve:

    • In vitro activity assays with varying calcium concentrations

    • Calmodulin-binding assays

    • Mutational analysis of potential calcium or calmodulin binding domains

Understanding post-translational modifications of AtDGK1 is essential for explaining why the enzyme might show different activities in vivo versus in vitro, and how its function is regulated in response to different cellular conditions and environmental stimuli.

What are the optimal conditions for expressing recombinant AtDGK1 in heterologous systems?

Expressing functional recombinant AtDGK1 requires careful optimization of expression systems and conditions. While specific details for AtDGK1 expression are not provided in the search results, general methodological approaches can be outlined based on related research:

  • Expression System Selection:

    • Bacterial systems (E. coli): May be suitable for initial expression attempts due to simplicity and high yield, but proper folding of plant membrane-associated proteins can be challenging

    • Yeast systems: Offer eukaryotic processing capabilities; search result mentions successful heterologous expression of yeast Dgk1

    • Insect cell systems: Provide advanced eukaryotic processing for complex proteins

    • Plant expression systems: May provide the most native environment for proper folding and post-translational modifications

  • Expression Construct Design:

    • Include appropriate affinity tags (His, GST, etc.) for purification

    • Consider fusion partners to enhance solubility

    • Design constructs with and without predicted transmembrane domains to enhance solubility if necessary

    • Include appropriate plant-optimized codon usage for the expression system

  • Expression Conditions Optimization:

    • Test various induction conditions (temperature, inducer concentration, duration)

    • For membrane-associated proteins like AtDGK1, lower expression temperatures (16-20°C) often enhance proper folding

    • Include appropriate cofactors or lipids in the growth medium if necessary

  • Purification Strategy:

    • For membrane-associated proteins, test different detergents for solubilization

    • Consider native purification conditions to maintain enzymatic activity

    • Include stability-enhancing agents during purification (glycerol, reducing agents)

The challenge with AtDGK1 expression may relate to previous findings that it was not active in vitro , suggesting that specific cofactors, post-translational modifications, or interaction partners might be necessary for its activity.

What methods are most effective for measuring AtDGK1 enzymatic activity in vitro?

Measuring AtDGK1 enzymatic activity requires sensitive and specific assays that account for its biochemical properties. Several methodological approaches can be considered:

  • Radiometric Assays:

    • Using radiolabeled substrates ([γ-32P]ATP or [γ-32P]CTP) to track phosphate incorporation into DAG

    • Separation of products by thin-layer chromatography (TLC)

    • Quantification by phosphorimaging or scintillation counting

    • Advantage: High sensitivity; Limitation: Requires radioisotope handling

  • Coupled Enzyme Assays:

    • Similar to the method mentioned in search result for measuring PA levels

    • Enzymatic conversion of PA to a fluorescent product

    • Advantage: Avoids radioisotopes; Limitation: Potential interference from coupling enzymes

  • Mass Spectrometry-Based Assays:

    • Direct measurement of DAG substrate consumption and PA product formation

    • Allows simultaneous analysis of multiple lipid species

    • Advantage: Provides detailed molecular species information; Limitation: Requires specialized equipment

  • Phosphate Release Assays:

    • Measuring released phosphate from nucleotide donors using colorimetric methods

    • Advantage: Simple setup; Limitation: Lower specificity, background phosphate issues

Key considerations for reliable AtDGK1 activity measurements include:

  • Appropriate detergent selection to maintain enzyme structure while providing access to lipid substrates

  • Inclusion of potential cofactors (divalent cations like Mg2+ or Mn2+)

  • Optimal pH and temperature conditions

  • Proper substrate presentation (micelles, vesicles, or supported lipid bilayers)

  • Controls to distinguish AtDGK1 activity from other lipid kinases

Since AtDGK1 was previously reported to be inactive in vitro , special attention should be paid to assay conditions that might enable its activity, such as specific lipid environments, regulatory factors, or post-translational modifications.

How can researchers address functional redundancy between AtDGK1 and other DGK isoforms in Arabidopsis?

Functional redundancy among DGK isoforms presents a significant challenge in elucidating the specific roles of AtDGK1. Based on the search results and experimental principles, researchers can address this challenge through several strategic approaches:

  • Genetic Approaches:

    • Multiple Gene Knockouts: Generate and characterize higher-order mutants combining dgk1 with mutations in other DGK genes. The search results describe that while single dgk2 or dgk4 mutants were viable, the double mutant was gametophyte lethal . Similar approaches with AtDGK1 could reveal redundant functions.

    • Inducible Knockdown Systems: Use RNAi or CRISPR interference with inducible promoters to overcome potential lethality of constitutive knockouts.

    • Tissue-Specific Gene Silencing: Target AtDGK1 knockdown to specific tissues to overcome whole-plant lethality issues.

  • Biochemical Differentiation:

    • Isoform-Specific Inhibitors: Develop compounds that specifically inhibit AtDGK1 without affecting other DGK isoforms.

    • Substrate Specificity Analysis: Determine if AtDGK1 has unique substrate preferences compared to other DGKs, which could indicate specialized functions.

  • Expression Pattern Analysis:

    • High-Resolution Expression Mapping: Utilize single-cell RNA-seq to identify cell types where AtDGK1 is uniquely expressed without other redundant DGKs.

    • Stress and Developmental Regulation: Identify conditions where AtDGK1 expression changes independently of other DGKs.

  • Protein Interaction Studies:

    • Isoform-Specific Protein Interactors: Identify proteins that interact specifically with AtDGK1 but not other DGKs, suggesting unique signaling roles.

    • Interaction-Based Functional Assays: Develop assays based on specific protein interactions to measure AtDGK1 function.

The search results indicate that different DGK isoforms in Arabidopsis show distinct expression patterns across tissues and developmental stages , suggesting that despite potential redundancy, there may be specific contexts where AtDGK1 plays non-redundant roles that could be uncovered through careful experimental design.

What are the challenges in resolving contradictory findings about AtDGK1 activity in vitro versus in vivo?

Resolving the discrepancy between AtDGK1's reported lack of activity in vitro and its presumed activity in vivo presents a complex research challenge. Several methodological approaches can help address this contradiction:

  • Reconstitution Experiments:

    • Lipid Environment Optimization: Test various lipid compositions, as membrane lipid environment may be critical for AtDGK1 activity.

    • Interacting Partner Addition: Systematically add potential interacting proteins that might be required for AtDGK1 activation.

    • Post-Translational Modifications: Similar to yeast Dgk1, which requires phosphorylation for optimal activity , AtDGK1 might need specific modifications.

  • Advanced Activity Detection Methods:

    • In-Gel Activity Assays: Develop non-denaturing gel systems that preserve protein interactions and detect activity directly.

    • Single-Molecule Enzymology: Apply techniques that can detect low or transient enzymatic activity that might be missed in bulk assays.

    • Native Mass Spectrometry: Analyze AtDGK1 in native conditions to detect structural features associated with activity.

  • Comparative Approaches:

    • Cross-Species Complementation: Test if AtDGK1 can complement defects in other systems where DGK activity can be more readily measured.

    • Chimeric Proteins: Create fusion proteins between AtDGK1 and active DGKs to identify domains responsible for activity regulation.

  • In Situ Activity Measurements:

    • Live-Cell Lipid Sensors: Develop and use fluorescent biosensors to detect DAG and PA dynamics in living plant cells with and without AtDGK1.

    • Metabolic Labeling: Use stable isotope-labeled precursors to track lipid metabolism pathways in intact cells.

The search results suggest that DGK activity is present in multiple membrane compartments, potentially involving AtDGK1 , despite its reported lack of in vitro activity. This indicates that specific cellular contexts or factors are likely required for its activation, which need to be systematically identified and incorporated into in vitro experimental designs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.