Recombinant Arabidopsis thaliana Diacylglycerol O-acyltransferase 2 (DGAT2)

Shipped with Ice Packs
In Stock
Cat. No.
BT2488686
Source
in vitro E.coli expression system
Synonyms
DGAT2; At3g51520; F26O13.160; Diacylglycerol O-acyltransferase 2; AtDGAT2
Quick Inquiry

Description

Introduction to DGAT2 in Arabidopsis thaliana

DGAT2 belongs to the type 2 diacylglycerol acyltransferase family, distinct from DGAT1 (membrane-bound O-acyltransferase family) and DGAT3 (cytosolic iron-sulfur cluster-containing enzyme) . Unlike DGAT1, which dominates TAG synthesis in Arabidopsis seeds, DGAT2 plays a specialized role in substrate-specific TAG assembly, particularly incorporating unusual or polyunsaturated fatty acids (FAs) . Recombinant DGAT2 refers to the enzyme produced through heterologous expression systems like yeast (Saccharomyces cerevisiae), enabling functional and structural studies .

Biochemical Characteristics

Recombinant Arabidopsis DGAT2 exhibits distinct structural and enzymatic properties:

  • Domain Architecture: Contains two predicted transmembrane helices near the N-terminus, critical for substrate specificity .

  • Molecular Weight: ~37 kDa (predicted), with a conserved DAG O-acyltransferase domain spanning residues 24–332 .

  • Localization: Associates with lipid droplets (LDs) in yeast, suggesting a role in LD biogenesis .

Table 2: Fatty Acid Composition of TAGs Produced by Recombinant DGAT2 in Yeast

Fatty AcidDGAT2 (%)DGAT1 (%)
16:06.032.0
16:136.212.5
18:06.08.0
18:148.640.0
Data derived from yeast H1246 complementation assays .

Role in Lipid Metabolism and Substrate Specificity

Recombinant DGAT2 influences lipid remodeling through distinct mechanisms:

  • Seed-Specific Overexpression: In transgenic Arabidopsis:

    • Increased oleic acid (18:1) by 2-fold in fad3fae1 mutants, reaching >50% of total seed FAs .

    • Elevated polyunsaturated FAs (18:2 and 18:3) in TAGs when expressed in wild-type seeds .

  • Regulatory Role: Upregulates genes in the PPAR signaling and glycerolipid metabolism pathways, enhancing adipogenesis .

Comparative Analysis with Other DGAT Enzymes

  • DGAT1 vs. DGAT2:

    • DGAT1 increases total oil content (~15–46% in seeds), while DGAT2 modifies FA composition without altering oil quantity .

    • DGAT2 is critical for incorporating unusual FAs (e.g., ricinoleic acid in castor bean) .

  • DGAT3: A cytosolic iron-sulfur protein with distinct substrate preferences (C18:3-rich TAGs), unrelated to DGAT2’s membrane-bound activity .

Biotechnological Applications

Recombinant DGAT2 holds promise for metabolic engineering:

  • Oilseed Modification: Enhances unsaturated FA content in crops (e.g., soybean, maize) .

  • Biofuel Production: Optimizes TAG profiles for biodiesel feedstocks .

  • Pharmaceuticals: Produces specialty lipids with hydroxylated or conjugated FAs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DGAT2; At3g51520; F26O13.160; Diacylglycerol O-acyltransferase 2; AtDGAT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
DGAT2
Target Protein Sequence
MGGSREFRAEEHSNQFHSIIAMAIWLGAIHFNVALVLCSLIFLPPSLSLMVLGLLSLFIF IPIDHRSKYGRKLARYICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGVVAL CDLTGFMPIPNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYSCVLVPGGV QETFHMQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCDLYLKLSRA IRFTPICFWGVFGSPLPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFER HKSRVGYDLELKIL
Uniprot No.
Q9ASU1

Target Background

Function
This recombinant Arabidopsis thaliana Diacylglycerol O-acyltransferase 2 (DGAT2) is involved in triacylglycerol (TAG) synthesis. Specifically, it catalyzes the acylation of the sn-3 hydroxy group of sn-1,2-diacylglycerol using acyl-CoA. It utilizes oleoyl-CoA, linoleoyl-CoA, and linolenoyl-CoA as substrates, exhibiting a preference for linolenoyl-CoA or oleoyl-CoA over linoleoyl-CoA.
Gene References Into Functions
  1. Expression of a codon-optimized DGAT2 gene restores neutral lipid accumulation in a Saccharomyces cerevisiae mutant strain. [PMID: 24663078](https://www.ncbi.nlm.nih.gov/pubmed/24663078)
  2. Immunogold labeling localizes DGAT2 to lipid bodies associated with microtubules, suggesting a potential role for microtubules in lipid biosynthesis. [PMID: 23042274](https://www.ncbi.nlm.nih.gov/pubmed/23042274)
Database Links

KEGG: ath:AT3G51520

STRING: 3702.AT3G51520.1

UniGene: At.28717

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet.
Tissue Specificity
Ubiquitous. Lower levels in seeds than in other tissues. Expressed in embryo and root meristematic cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.