Recombinant Arabidopsis thaliana Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

Shipped with Ice Packs
In Stock

Description

2.1. N-Linked Glycosylation

DAD1 is a subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the transfer of oligosaccharides to asparagine residues in nascent polypeptides. This process ensures proper protein folding and ER export .

2.2. Apoptosis Regulation

DAD1 suppresses programmed cell death (PCD) by maintaining N-glycosylation efficiency. Loss of DAD1 triggers ER stress and apoptosis via the Perk/Atf4 pathway . In plants, DAD1 deficiency disrupts jasmonic acid biosynthesis, leading to developmental defects in anther dehiscence and pollen maturation .

2.3. Plant Defense Mechanisms

Overexpression of DAD1 orthologs enhances resistance to pathogens like Phytophthora by stabilizing N-glycosylated defense proteins (e.g., PR1, PR2) . Conversely, silencing DAD1 compromises innate immunity in soybean and wheat .

3.1. Complementation Studies

  • Mammalian Systems: A. thaliana DAD1 rescues apoptosis in hamster tsBN7 cells, confirming functional conservation .

  • Plant Systems: dad1 mutants exhibit JA deficiency, reversible via exogenous JA application .

3.2. Enzymatic Activity

Recombinant DAD1 hydrolyzes phospholipids in an sn-1–specific manner, linking it to JA biosynthesis .

3.3. Protein Interactions

DAD1 interacts with MCL1 (Bcl-2 family protein) and OST complex components, suggesting dual roles in apoptosis and glycosylation .

Production and Purification

Recombinant DAD1 is produced in mammalian cell systems (e.g., HEK293) with the following specifications:

ParameterDetail
Expression SystemMammalian cells
Purity>85% (SDS-PAGE)
Storage-80°C in 50% glycerol; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water

Applications in Biotechnology

  1. Protein Folding Studies: Used to investigate N-glycosylation’s role in ER quality control .

  2. Plant Stress Responses: Silencing/overexpression models reveal DAD1’s role in pathogen resistance and stress signaling .

  3. Apoptosis Pathways: Tools for studying ER stress-induced PCD in eukaryotes .

Gene Ontology Annotations

Key annotations from A. thaliana DAD1 (source: LIPID MAPS ):

GO IDCategoryDescription
GO:0005783CellularEndoplasmic reticulum
GO:0016021CellularIntegral component of membrane
GO:0006915BiologicalApoptotic process regulation
GO:0006486BiologicalProtein glycosylation

Evolutionary Conservation

DAD1 is highly conserved across eukaryotes:

OrganismOrtholog Function
Homo sapiens (UniProt: P61803)Apoptosis suppression; OST complex stabilization
Drosophila melanogasterTissue development via N-glycosylation
Glycine max (GmDAD1)Phytophthora resistance via ER stress modulation

Challenges and Future Directions

  • Mechanistic Gaps: The exact role of DAD1 in OST-independent apoptosis pathways remains unclear .

  • Biotechnological Potential: Engineering DAD1 variants could enhance crop resilience to biotic/abiotic stresses .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
DAD1; At1g32210; F3C3.14; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; AtDAD1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Target Protein Sequence
MVKSTSKDAQDLFRSLRSAYSATPTNLKIIDLYVVFAVFTALIQVVYMALVGSFPFNSFL SGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG
Uniprot No.

Target Background

Function
DAD1 is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process represents the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the OST complex associates with the Sec61 complex at the channel-forming translocon complex, which mediates protein translocation across the endoplasmic reticulum (ER). The presence of all subunits is essential for achieving maximal enzyme activity.
Database Links

KEGG: ath:AT1G32210

STRING: 3702.AT1G32210.1

UniGene: At.32

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is the dual functional role of DAD1 in Arabidopsis thaliana?

Arabidopsis thaliana DAD1 (DEFENDER AGAINST APOPTOTIC DEATH 1) serves two distinct and critical functions in plant biology. Primary research demonstrates that DAD1 functions as a subunit of the oligosaccharyltransferase (OT) complex that catalyzes N-glycosylation of nascent secretory polypeptides in the endoplasmic reticulum lumen . This process is fundamental for proper protein folding and function in the secretory pathway. Simultaneously, DAD1 has been characterized as a chloroplastic phospholipase A1 (PLA1) that catalyzes the initial step of jasmonic acid (JA) biosynthesis . The PLA1 activity specifically hydrolyzes phospholipids in an sn-1–specific manner, releasing fatty acids that serve as precursors for JA synthesis . This dual functionality makes DAD1 a particularly interesting target for researchers studying both protein post-translational modifications and plant hormone biosynthesis pathways.

How does DAD1 mutation affect plant development and reproduction?

The dad1 mutant exhibits several distinct phenotypic defects primarily related to reproductive development. Genetic studies reveal that dad1 mutants display significant impairments in anther dehiscence (the process by which anthers open to release pollen), pollen maturation, and flower opening . These reproductive defects are directly linked to reduced jasmonic acid accumulation, as the total amount of JA in dad1 flower buds is decreased to approximately 22% of wild-type levels . Importantly, these developmental defects can be rescued through exogenous application of jasmonic acid (JA) or linolenic acid (LA), but not by linoleic acid, oleic acid, or stearic acid, which cannot serve as JA precursors . This rescue experiment conclusively demonstrates that the developmental phenotypes result from disrupted JA biosynthesis rather than other potential functions of DAD1.

What protein complexes incorporate DAD1 and how are they characterized?

DAD1 functions as an essential component of the oligosaccharyltransferase (OT) complex. Mass spectrometry analysis of purified complexes has identified the core subunits that interact with DAD1, including STAUROSPORINE AND TEMPERATURE SENSITIVE3a (STT3a), OLIGOSACCHARYLTRANSFERASE1 (OST1), HAPLESS6 (HAP6), and DEFECTIVE GLYCOSYLATION1 (DGL1) . Transmission electron microscopy studies have revealed that the STT3a-containing OT complex associates with ribosomes to form OT-ribosome super-complexes in vivo . These protein-protein interactions can be further validated through pairwise in planta interaction analyses, which confirm that all OT subunits identified in animal systems are conserved in Arabidopsis and physically interact with STT3a . Genetic analyses of OT subunit mutants have established that both OST1 and DAD1/2 subunits are essential for plant viability, though individual isoform mutations produce milder phenotypes than mutations in DGL1, OST3/6, or STT3a .

What expression systems are optimal for producing functional recombinant Arabidopsis thaliana DAD1 protein?

Multiple expression systems have been validated for producing recombinant Arabidopsis thaliana DAD1 protein with varying advantages depending on experimental objectives. The most widely documented systems include:

Expression SystemAdvantagesLimitationsTypical PurityApplications
E. coliRapid production, high yield, economicalPotential lack of post-translational modifications≥85% by SDS-PAGE Biochemical assays, antibody production
YeastEukaryotic processing, higher-order foldingLonger production time than bacterial systems≥85% by SDS-PAGE Functional studies requiring glycosylation
BaculovirusInsect cell expression, complex foldingMore resource-intensive≥85% by SDS-PAGE Structural studies, functional assays
Mammalian CellMost native-like modificationsHighest cost, technical complexity≥85% by SDS-PAGE Interaction studies, therapeutic research
Cell-Free ExpressionRapid, avoids cellular toxicity issuesMay have lower yields≥85% by SDS-PAGE Quick screening, toxic protein expression

For structural biology applications, particularly for studying DAD1 as part of the OT complex, the Arabidopsis protein super-expression platform utilizing tandem affinity-tagged STT3a has proven effective for purifying intact complexes suitable for transmission electron microscopy analysis . This system allows DAD1 to be studied in its native multi-protein assembly rather than in isolation.

How can researchers effectively analyze DAD1's phospholipase activity in jasmonic acid biosynthesis?

Methodologically rigorous analysis of DAD1's phospholipase activity requires a multi-faceted approach:

  • Enzyme activity assays: Recombinant DAD1 expressed in E. coli can be purified and tested for its ability to hydrolyze phospholipids with sn-1 specificity. Experimental validation has confirmed that DAD1 protein hydrolyzes phospholipids in this specific manner, confirming its classification as a phospholipase A1 .

  • Subcellular localization: DAD1-green fluorescent protein fusion constructs expressed in leaf epidermal cells localize predominantly to chloroplasts, consistent with its role in releasing chloroplast membrane lipids for JA biosynthesis . This localization can be visualized through confocal microscopy and fractionation studies.

  • Complementation studies: The functionality of recombinant or mutant DAD1 can be assessed through complementation of the dad1 mutant phenotype. Successful complementation should restore normal anther dehiscence, pollen maturation, and flower opening .

  • Metabolite quantification: Gas chromatography-mass spectrometry can be employed to quantify JA and methyl jasmonate (MeJA) levels in plant tissues. In dad1 mutants, these compounds are reduced to approximately 22% of wild-type levels in flower buds . This quantitative approach provides a direct measure of DAD1's contribution to the JA biosynthetic pathway.

What methodological approaches can resolve DAD1's dual roles in stress responses?

DAD1 and DAD1-like lipases have been implicated in multiple stress response pathways, requiring careful experimental design to delineate their specific contributions. Recommended methodological approaches include:

  • Differential gene expression analysis: Transcriptomic data from the AtGenExpress project can be analyzed to identify tissue-specific and stress-specific expression patterns of DAD1 and related lipases .

  • Stress-specific phenotyping: Comparative analysis of wild-type, dad1 mutant, and other DAD1-like lipase mutants (e.g., PLA-Iγ1 and PLA-Iβ2) under osmotic stress conditions reveals their functional redundancy and specialization. Seed germination assays under salt and sorbitol treatment provide quantifiable metrics for stress responses .

  • Genetic complementation matrix: Cross-complementation studies with different DAD1-like lipases can determine the degree of functional overlap in different stress contexts. This approach has revealed that lipases impaired in wound response (PLA-Iγ1 and PLA-Iβ2) are also affected in their response to osmotic stress .

  • Temporal analysis of lipid remodeling: Lipidomic analysis at different time points after stress application can distinguish between DAD1's roles in immediate stress response (membrane remodeling) versus longer-term signaling processes (jasmonate production).

What controls should be included when studying recombinant DAD1 function in heterologous systems?

When studying recombinant Arabidopsis thaliana DAD1 in heterologous systems, multiple controls must be implemented to ensure valid interpretation:

  • Expression vector controls: Include empty vector transformants to control for effects of the expression system itself.

  • Enzymatic activity controls: For lipase activity assays, include:

    • Heat-inactivated recombinant DAD1 (negative control)

    • Commercial phospholipase with known activity (positive control)

    • Substrate-only reactions (background control)

  • Substrate specificity controls: Test DAD1 activity against multiple lipid substrates beyond the hypothesized targets to verify specificity. For example, when testing DAD1's role in releasing linolenic acid, controls should include reactions with linoleic acid, oleic acid, and stearic acid, which cannot serve as JA precursors .

  • Functional rescue controls: When performing complementation studies in dad1 mutants, include:

    • Wild-type plants treated identically to mutants

    • dad1 mutants treated with JA as positive control

    • dad1 mutants treated with non-JA-precursor fatty acids as negative controls

    • Other JA biosynthesis mutants (e.g., dde1/opr3) to verify pathway specificity

  • Protein quality controls: Verify the integrity and proper folding of the recombinant protein through:

    • SDS-PAGE to confirm expected molecular weight (≥85% purity standard)

    • Western blotting with specific antibodies

    • Circular dichroism to assess secondary structure

How can researchers address functional redundancy when studying DAD1 in complex physiological processes?

Functional redundancy within the DAD1-like lipase family presents significant challenges for researchers. Methodological approaches to address this include:

  • Higher-order mutant generation: Create double or triple mutants of DAD1 and related genes (e.g., DGL, PLA-Iγ1) to reveal redundant functions that may be masked in single mutants.

  • Tissue-specific expression analysis: Utilize DAD1 promoter::β-glucuronidase (GUS) reporter constructs to identify tissues with high DAD1 expression, focusing studies on these specific tissues to minimize confounding effects from redundant lipases .

  • Conditional expression systems: Implement inducible expression systems to control DAD1 expression temporally, allowing for the study of acute versus chronic effects of DAD1 deficiency.

  • Quantitative phenotyping: Develop sensitive, quantitative assays for phenotypes of interest. For example, precisely measure anther dehiscence timing, pollen viability percentages, or quantify flower opening angles rather than using binary assessments .

  • Pathway-specific metabolite profiling: Quantify downstream metabolites in specific pathways, such as measuring jasmonates by gas chromatography-mass spectrometry, which revealed that dad1 mutants retain 22% of wild-type JA levels, indicating partial functional compensation by other lipases .

What experimental approaches can distinguish between DAD1's roles in the OT complex versus JA biosynthesis?

Differentiating between DAD1's dual functions requires carefully designed experiments that can isolate each pathway:

  • Domain-specific mutations: Generate recombinant DAD1 variants with targeted mutations in:

    • The conserved lipase active site motif to specifically disrupt lipase activity

    • Regions involved in OT complex incorporation but not lipase activity

  • Rescue experiments with pathway-specific interventions:

    • Exogenous JA application rescues reproductive phenotypes without affecting N-glycosylation defects

    • Expression of heterologous N-glycosylation machinery components may rescue glycosylation defects without affecting JA biosynthesis

  • Subcellular compartment-specific targeting:

    • Create DAD1 variants with enhanced chloroplast targeting to prioritize JA biosynthesis function

    • Design variants with enforced ER retention to prioritize OT complex function

  • Temporal separation of functions:

    • Utilize developmental stages where one function predominates (e.g., flowering for JA function, early development for essential OT complex function)

    • Implement stress conditions that specifically engage one pathway over the other

  • Biochemical separation of complexes:

    • Isolate OT-ribosome super-complexes through tandem affinity purification of STT3a

    • Separate chloroplast membranes to study DAD1's lipase activity independently

What technological advances would enhance structural studies of the DAD1 protein?

Current structural knowledge of DAD1 remains limited, with significant opportunities for technological advancement:

  • Cryo-electron microscopy optimization: The Arabidopsis protein super-expression platform has already demonstrated utility for transmission electron microscopy studies of OT-ribosome super-complexes . Further optimization could yield higher-resolution structures through cryo-EM approaches.

  • Cross-linking mass spectrometry: Implementing chemical cross-linking followed by mass spectrometry could map DAD1's interaction interfaces within the OT complex without requiring full structural determination.

  • Hydrogen-deuterium exchange mass spectrometry: This approach could identify dynamic regions of DAD1 and conformational changes upon substrate binding or complex assembly.

  • Single-particle tracking in vivo: Developing methods to track individual DAD1 molecules in living plant cells could reveal its dynamic association with different complexes and compartments.

  • AlphaFold-based structural prediction validation: Computational structure predictions could guide targeted mutagenesis experiments to validate functional domains and interaction surfaces.

How might DAD1's functions be leveraged for agricultural applications?

Understanding DAD1's dual roles suggests several potential agricultural applications:

  • Stress-resilient crop development: The involvement of DAD1-like lipases in salt and osmotic stress responses suggests that modulating their expression could enhance crop tolerance to environmental stresses.

  • Reproductive timing control: DAD1's role in synchronizing anther dehiscence, pollen maturation, and flower opening could be exploited to control flowering time and reproductive success in crop plants.

  • Protein glycosylation engineering: Manipulating DAD1 and other OT complex components could allow for customized glycosylation patterns in plant-produced biopharmaceuticals.

  • JA signaling modulation: Targeted control of DAD1 activity in specific tissues could fine-tune JA-mediated defense responses without compromising growth and development.

  • Male sterility systems: Controlled disruption of DAD1 function could create reversible male sterility systems for hybrid seed production, as dad1 mutants exhibit defects in anther dehiscence that can be chemically complemented .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.