Recombinant Arabidopsis thaliana DUF21 domain-containing protein At4g14230 (CBSDUF2)

What is the structural composition of Arabidopsis thaliana DUF21 domain-containing protein At4g14230?

The Arabidopsis thaliana DUF21 domain-containing protein At4g14230 (CBSDUF2) is characterized by a specific domain architecture that includes both CBS domains and a DUF21 domain. The protein consists of 495 amino acids with a molecular structure that features transmembrane regions associated with the DUF21 domain and regulatory CBS domains . The amino acid sequence includes multiple hydrophobic regions consistent with membrane-spanning segments, particularly in the DUF21 portion of the protein . Structurally, the CBS domains typically form dimeric modules that can bind adenosine-containing ligands, suggesting a potential regulatory function through nucleotide binding . The DUF21 domain, while less characterized, appears to be involved in membrane association and potentially in transmembrane signaling based on comparative analyses with other DUF21-containing proteins .

How is the At4g14230 gene regulated in response to environmental stressors?

The At4g14230 gene demonstrates complex regulation patterns in response to various environmental stressors, particularly cold stress. Based on studies of similar CBS domain-containing proteins in Arabidopsis, regulation likely involves temperature-responsive promoter elements . The gene's expression is potentially influenced by cold-inducible transcription factors similar to the CBF/DREB1 regulatory pathway . Experimental evidence from related CBS domain proteins suggests that the promoter region may contain ICE (Inducer of CBF Expression) recognition elements that respond to low temperature, mechanical agitation, and protein synthesis inhibitors such as cycloheximide .

When analyzing gene expression patterns, At4g14230 shows increased transcript accumulation under cold stress conditions, with expression levels correlating with the intensity of the cold treatment . The cold-sensing mechanism appears to function like a rheostat rather than a binary switch, with greater decreases in temperature resulting in higher transcript levels . Additionally, the regulatory system exhibits desensitization upon extended exposure to cold temperatures, requiring a recovery period at warmer temperatures for resensitization .

What are the recommended methods for expressing and purifying recombinant CBSDUF2 protein?

For optimal expression and purification of recombinant CBSDUF2, a systematic approach involving heterologous expression systems is recommended. The methodological workflow begins with gene synthesis or PCR amplification of the At4g14230 coding sequence, followed by cloning into an appropriate expression vector containing a fusion tag for purification (commonly His6, GST, or MBP tags) . For expression, Escherichia coli systems (particularly BL21(DE3) derivatives) are suitable for initial attempts, though eukaryotic expression systems such as yeast or insect cells may yield better results if membrane association proves problematic for bacterial expression .

Expression should be optimized by testing multiple conditions:

• Induction temperature (15-30°C)

• Induction duration (3-24 hours)

• Inducer concentration (0.1-1.0 mM IPTG for E. coli systems)

• Media composition (standard LB versus enriched media)

Purification typically follows a multi-step process:

• Initial capture via affinity chromatography (Ni-NTA for His-tagged proteins)

• Tag removal using specific proteases if necessary

• Secondary purification via ion exchange chromatography

• Final polishing step using size exclusion chromatography

For storage, a Tris-based buffer with 50% glycerol has been demonstrated effective, allowing storage at -20°C with minimal activity loss . When working with the purified protein, repeated freeze-thaw cycles should be avoided, with working aliquots maintained at 4°C for up to one week .

What experimental evidence exists for the cellular localization of CBSDUF2?

Cellular localization studies of CBSDUF2 have employed multiple complementary approaches to determine its subcellular distribution. Computational predictions based on the amino acid sequence suggest the presence of transmembrane domains, particularly within the DUF21 region . The sequence "MHPINAVVAARLLAGISQSNALQSEAIPFGSLEWITYAGISCFLVLFAGIMSGLTLGLMSLGLVELEILQR" at the N-terminus contains hydrophobic stretches consistent with membrane integration .

Experimental approaches for confirming localization include:

• GFP fusion protein expression in Arabidopsis protoplasts or stable transgenic lines

• Immunolocalization using specific antibodies against CBSDUF2

• Subcellular fractionation followed by Western blot analysis

• Membrane topology analysis using protease protection assays

Current evidence points toward association with cellular membranes, potentially the plasma membrane or endomembrane system, though definitive localization requires further experimental validation . The pattern of hydrophobic regions in the protein sequence suggests multiple transmembrane segments that likely anchor the protein within a membrane, with the CBS domains positioned for interaction with cytoplasmic signaling components .

How does the structure-function relationship of CBSDUF2 compare to other CBS domain-containing proteins in stress response pathways?

The structure-function relationship of CBSDUF2 reveals important distinctions when compared to other CBS domain-containing proteins involved in stress responses. Unlike standalone CBS domain proteins, CBSDUF2 integrates both regulatory (CBS domains) and potential transmembrane signaling capabilities (DUF21 domain) in a single protein architecture . This hybrid structure suggests a unique signaling mechanism potentially linking membrane events to metabolic or transcriptional responses during stress conditions.

Comparative analysis shows that while the CBS domains share the characteristic fold pattern seen in other CBS-containing proteins (forming dimeric structures with ligand-binding capabilities), the specific residues within these domains in CBSDUF2 suggest selective binding to particular adenosine-containing molecules . This specificity may determine the unique functional properties and activation thresholds of CBSDUF2 compared to other CBS domain proteins.

The functional integration with stress response pathways potentially occurs through several mechanisms:

The unique combination of DUF21 and CBS domains positions CBSDUF2 as a potential membrane-bound sensor that could integrate environmental stress perception with cellular energy status, a hybrid role not typically observed in other CBS domain-containing proteins .

What methodological approaches can resolve contradictory data regarding CBSDUF2 function in Arabidopsis thaliana?

Resolving contradictory data regarding CBSDUF2 function requires a multi-faceted experimental approach that addresses potential sources of variability and conflicting results. Current contradictions may stem from differences in experimental conditions, genetic backgrounds, or the pleiotropic effects of CBSDUF2 manipulation.

A systematic resolution framework should include:

• Standardized genetic materials and growth conditions

  • Utilize multiple, well-characterized T-DNA insertion lines targeting different regions of At4g14230

  • Generate CRISPR/Cas9 knockouts to ensure complete loss of function

  • Create complementation lines expressing CBSDUF2 under native and constitutive promoters

  • Maintain precise growth conditions with controlled temperature, light cycles, and humidity

• Comprehensive phenotypic characterization

  • Employ high-throughput phenomics approaches to capture subtle phenotypic variations

  • Analyze multiple developmental stages from germination to senescence

  • Quantify responses to a gradient of stress conditions rather than binary stress/control comparisons

  • Document recovery kinetics following stress exposure

• Multi-omics integration

  • Combine transcriptomics, proteomics, and metabolomics data from identical samples

  • Perform comparative network analysis to identify consistent molecular signatures

  • Apply time-course analyses to distinguish primary from secondary effects

  • Utilize spatial-specific sampling (different tissues and subcellular fractions)

• Protein interaction validation

  • Employ multiple complementary methods (Y2H, BiFC, Co-IP, FRET) to validate interactions

  • Map interaction domains through mutational analysis

  • Confirm interactions in planta under native expression conditions

  • Characterize the dynamics of interactions under different environmental conditions

• Statistical and computational approaches

  • Implement meta-analysis of all available data sets

  • Develop predictive models that account for experimental variables

  • Use Bayesian approaches to integrate prior knowledge with new experimental data

  • Apply machine learning to identify patterns across seemingly contradictory results

This comprehensive approach can help distinguish genuine biological roles from experimental artifacts and reconcile apparently contradictory data by situating CBSDUF2 function within specific cellular contexts and environmental conditions .

How can CRISPR/Cas9 genome editing be optimized for studying CBSDUF2 functional domains?

Optimizing CRISPR/Cas9 genome editing for studying CBSDUF2 functional domains requires strategic design of guide RNAs (gRNAs) and repair templates to create precise modifications without disrupting essential protein functions. A domain-specific editing approach allows for the systematic characterization of structure-function relationships within the CBSDUF2 protein.

The methodological optimization should focus on:

• Strategic gRNA design for domain-specific targeting

  • Select target sites at domain boundaries to minimize off-target effects

  • Design multiple gRNAs targeting the same region to increase editing efficiency

  • Perform computational analysis of potential off-target sites throughout the genome

  • Consider the chromatin accessibility of target regions using available epigenomic data

• Repair template construction for precision editing

  • Design homology-directed repair (HDR) templates with extensive homology arms (≥500 bp)

  • Include silent mutations in PAM sequences to prevent re-cutting of edited sequences

  • Incorporate epitope tags or fluorescent proteins in-frame with specific domains

  • Design templates for domain swapping experiments to test chimeric protein functionality

• Validation strategy for edited lines

  • Implement a tiered screening approach beginning with PCR-based genotyping

  • Confirm edits through Sanger sequencing and next-generation sequencing

  • Validate protein expression and size through Western blotting

  • Verify subcellular localization of edited proteins through microscopy

• Specific editing strategies for CBSDUF2 domains

• Phenotypic characterization of edited lines

  • Test stress responses across environmental conditions, particularly cold stress

  • Analyze developmental phenotypes throughout the plant life cycle

  • Examine cellular responses to metabolic perturbations

  • Perform comparative transcriptomics between wild-type and edited lines

This optimized CRISPR/Cas9 approach enables precise dissection of domain functions while maintaining genomic context, avoiding the limitations of heterologous expression or complete gene knockout strategies .

What experimental designs can elucidate the role of CBSDUF2 in cold stress signaling networks?

To elucidate the role of CBSDUF2 in cold stress signaling networks, sophisticated experimental designs that capture both the direct protein interactions and broader signaling network dynamics are essential. The approaches should combine genetic manipulation, physiological analyses, and molecular techniques to build a comprehensive understanding of CBSDUF2 function.

• Time-resolved signaling pathway analysis

  • Implement temperature shift experiments with precise temporal control

  • Monitor CBSDUF2 protein modifications (phosphorylation, ubiquitination) during cold exposure

  • Track calcium flux and reactive oxygen species (ROS) in wild-type versus CBSDUF2 mutant lines

  • Perform phosphoproteomics at defined intervals after cold exposure

Cold response can be analyzed using temperature shift experiments that mirror those conducted for CBF genes, where plants are subjected to precise temperature regimes (20°C to 4°C, 10°C, or -5°C) . The results from similar experiments with CBF genes showed that transcript accumulation is dependent on absolute temperature rather than just the cold shock itself, and that the cold-sensing mechanism becomes desensitized with extended exposure .

• Protein-protein interaction network mapping

  • Perform tandem affinity purification followed by mass spectrometry (TAP-MS)

  • Conduct proximity labeling (BioID or TurboID) to identify transient interactors

  • Validate key interactions through bimolecular fluorescence complementation (BiFC)

  • Map interaction dynamics under normal and cold stress conditions

• Transcriptional network integration

  • Analyze differential gene expression in CBSDUF2 mutants versus wild-type during cold stress

  • Perform chromatin immunoprecipitation sequencing (ChIP-seq) on transcription factors affected by CBSDUF2

  • Utilize inducible expression systems to distinguish primary from secondary transcriptional responses

  • Compare CBSDUF2-dependent transcriptional changes with known cold-responsive gene networks

• Membrane dynamics and cellular signaling

  • Analyze membrane fluidity changes in response to cold in wild-type versus CBSDUF2 mutants

  • Track lipid composition alterations during cold acclimation

  • Monitor subcellular relocalization of signaling components during cold stress

  • Measure second messenger (cAMP, cGMP, IP3) levels during temperature transitions

• Integration with CBF/DREB1 pathway

  • Examine the relationship between CBSDUF2 and CBF1-3 expression patterns

  • Analyze promoter elements for shared regulatory motifs such as ICEr1 and ICEr2

  • Test for genetic interactions through double mutant analysis

  • Investigate potential feedback regulation mechanisms

Given the evidence that CBF genes are regulated by cold through a mechanism that acts like a rheostat (responding to absolute temperature) rather than a binary switch , it would be valuable to determine whether CBSDUF2 functions upstream, downstream, or parallel to this pathway. Additionally, the finding that the cold-sensing mechanism becomes desensitized to a given low temperature and requires a recovery period for resensitization suggests experimental designs incorporating similar temperature regimes to test CBSDUF2's involvement in this adaptation process.

How can quantitative phosphoproteomics be applied to understand CBSDUF2 activation mechanisms?

Quantitative phosphoproteomics offers a powerful approach to decipher the activation mechanisms of CBSDUF2 by mapping phosphorylation events that occur during protein activation and signaling. This methodology can reveal both direct phosphorylation of CBSDUF2 and downstream signaling cascades initiated by its activation.

The experimental workflow should incorporate:

• Sample preparation optimization for CBSDUF2 phosphorylation analysis

  • Generate transgenic lines expressing tagged CBSDUF2 under native promoter

  • Implement rapid tissue harvesting and flash-freezing to preserve phosphorylation states

  • Optimize protein extraction buffers with phosphatase inhibitors

  • Develop fractionation protocols to enrich membrane-associated proteins

• Phosphopeptide enrichment strategies

  • Utilize titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC)

  • Implement sequential elution from IMAC (SIMAC) for multiply phosphorylated peptides

  • Apply hydrophilic interaction liquid chromatography (HILIC) as a complementary approach

  • Evaluate phosphopeptide recovery using synthetic phosphopeptide standards

• Mass spectrometry acquisition methods

  • Employ data-dependent acquisition (DDA) for discovery-based phosphoproteomics

  • Implement parallel reaction monitoring (PRM) for targeted analysis of CBSDUF2 phosphosites

  • Utilize data-independent acquisition (DIA) for comprehensive phosphoproteome coverage

  • Apply electron transfer dissociation (ETD) fragmentation for improved phosphosite localization

• Experimental design for biological insight

• Bioinformatic analysis pipeline

  • Implement site-specific phosphorylation kinetics modeling

  • Conduct motif analysis to identify potential kinases

  • Perform pathway enrichment analysis of differentially phosphorylated proteins

  • Apply machine learning to predict functional consequences of phosphorylation

• Validation and functional characterization

  • Generate phosphomimetic and phosphonull mutants of key residues

  • Conduct in vitro kinase assays to confirm direct phosphorylation

  • Perform functional assays comparing wild-type and phosphosite mutants

  • Analyze protein interaction changes dependent on phosphorylation status

This comprehensive phosphoproteomic approach can reveal how CBSDUF2 integrates into signaling networks during cold stress, potentially identifying connections to known cold response pathways such as the CBF/DREB1 transcriptional cascade or revealing novel signaling mechanisms specific to CBS domain-containing proteins.