Recombinant Arabidopsis thaliana DUF21 domain-containing protein At5g52790 (CBSDUF5)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

CBSDUF5 is encoded by the AT5G52790 gene located on chromosome 5 of A. thaliana. Key molecular details include:

PropertyDetails
Gene LocusAT5G52790
UniProt IDQ9LTD8
Protein Length500 amino acids
DomainsTwo CBS domains (residues 39–69, 80–110) and one DUF21 domain (residues 185–350)
SynonymsCBSDUF5, F6N7.28, DUF21 domain-containing protein At5g52790

The protein is annotated as a transmembrane protein, though its precise cellular localization remains under investigation .

Functional Insights

CBSDUF5 is part of the CBSDUF subgroup, which combines CBS and DUF21 domains. Functional studies suggest roles in:

  • Abiotic stress responses: Overexpression of the soybean homolog GmCBS21 enhances low-nitrogen tolerance in A. thaliana .

  • Membrane transport: Structural homology to bacterial hemolysins implies potential ion-channel or transporter activity, though this remains unconfirmed .

  • Plant development: CBS-DUF21 proteins are implicated in leaf senescence and nutrient remobilization .

Table 3: Comparative Analysis of CBSDUF Homologs

SpeciesGeneProtein LengthFunction
A. thalianaAT5G52790500 aaStress adaptation, putative transporter
Glycine max (soybean)GmCBS21450 aaLow-nitrogen tolerance
Medicago truncatulaMtCBSDUF5476 aaUnknown

Recombinant Production and Applications

Recombinant CBSDUF5 is commercially available for research purposes, with protocols optimized for:

  • Protein-protein interaction studies: His tag facilitates affinity chromatography .

  • Structural biology: Used in X-ray crystallography or NMR to resolve DUF21 domain architecture .

  • Stress response assays: Functional validation via transgenic plant overexpression .

Research Gaps and Future Directions

  • DUF21 function: The DUF21 domain’s biochemical role remains uncharacterized, warranting mutagenesis studies .

  • In vivo localization: Subcellular localization (e.g., plasma membrane vs. organelles) requires confirmation via GFP tagging .

  • Mechanistic studies: Links between CBSDUF5 and nitrogen metabolism or stress signaling pathways are speculative and need validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to your requirements.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CBSDUF5; At5g52790; F6N7.28; DUF21 domain-containing protein At5g52790; CBS domain-containing protein CBSDUF5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-500
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CBSDUF5
Target Protein Sequence
MAANDVPCCETMFWVYLLVCVALVVFAGLMSGLTLGLMSLSIVELEVMIKAGEPHDRKNA EKILPLVKNQHLLLCTLLIGNALAMEALPIFVDSLLPAWGAILISVTLILAFGEIIPQAV CSRYGLSIGAKLSFLVRLIIIVFFPLSYPISKLLDLLLGKRHSTLLGRAELKSLVYMHGN EAGKGGELTHDETTIISGALDMSQKSAKDAMTPVSQIFSLDINFKLDEKTMGLIASAGHS RIPIYSVNPNVIIGFILVKNLIKVRPEDETSIRDLPIRRMPKVDLNLPLYDILNIFQTGR SHMAAVVGTKNHTNTNTPVHEKSINGSPNKDANVFLSIPALNSSETSHQSPIRYIDSISD EDEEVIGIITLEDVMEELIQEEIYDETDQYVELHKRITINMPMSGNSPETATWASELASP ISPYRSSLLSPSIMISTLLRSPINSPYRHSLLLRPTLHASPPAQSPSILSPDSNNERYYY LSPSRVLRKSYEKLSRSNGS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should CBSDUF5 protein be stored for optimal stability?

For optimal stability, the CBSDUF5 protein should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can damage protein structure and function. Working aliquots can be stored at 4°C for up to one week. The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

When reconstituting lyophilized protein, it is recommended to:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being recommended)

  • Aliquot for long-term storage at -20°C/-80°C

What expression systems are commonly used for producing recombinant CBSDUF5?

Based on the available data, E. coli is a common expression system used for producing recombinant CBSDUF5 protein. The full-length protein (amino acids 1-500) has been successfully expressed in E. coli with an N-terminal His tag . While other expression systems might be suitable, the bacterial system appears effective for obtaining sufficient quantities of functional protein for research purposes.

What is the predicted molecular function of the DUF21 domain in CBSDUF5?

The DUF21 domain is found in a variety of proteins across species, but its precise function remains largely unknown (hence "Domain of Unknown Function"). In CBSDUF5, the domain may be involved in membrane-associated functions, potentially related to stress responses or ion transport, based on its sequence characteristics and the presence of transmembrane regions .

Recent research on DUF21-containing proteins in other organisms suggests potential roles in:

  • Ion homeostasis

  • Stress response signaling

  • Membrane organization

  • Protein-protein interactions at the membrane interface

Researchers investigating CBSDUF5 function may want to design experiments that test these hypotheses through:

  • Protein-protein interaction studies (e.g., pull-down assays, yeast two-hybrid)

  • Membrane localization experiments

  • Ion transport assays

  • Stress response phenotyping of knockout or overexpression lines

How does CBSDUF5 relate to other CBS domain-containing proteins in Arabidopsis?

CBSDUF5 contains a CBS (Cystathionine Beta-Synthase) domain, which is found in diverse proteins across species. In Arabidopsis, numerous CBS domain-containing proteins exist, many with regulatory functions. The relationship between CBSDUF5 and other CBS domain proteins may involve:

  • Potential functional redundancy with other CBS-DUF21 family members

  • Participation in common signaling networks or protein complexes

  • Similar regulatory mechanisms responding to cellular energy status

For comprehensive analysis of relationships between CBS domain proteins:

  • Perform phylogenetic analysis of all CBS domain-containing proteins in Arabidopsis

  • Compare expression patterns across tissues and development

  • Analyze promoter regions for common regulatory elements

  • Test for genetic interactions through double/triple mutant analysis

What phenotypes are associated with CBSDUF5 overexpression or knockout in Arabidopsis?

While specific phenotypic data for CBSDUF5 mutants is not directly provided in the search results, researchers might investigate:

  • Root development phenotypes - given the context of lateral root development research in Arabidopsis

  • Stress response phenotypes - many membrane proteins are involved in abiotic stress responses

  • Nutrient homeostasis - CBS domain proteins often respond to energy status and nutrient availability

Methodological approach for phenotypic analysis:

  • Generate knockout lines using T-DNA insertion or CRISPR-Cas9

  • Create overexpression lines using constitutive (35S) or tissue-specific promoters

  • Assess growth under normal and stress conditions (drought, salt, nutrient limitation)

  • Analyze developmental timing and morphological characteristics

  • Perform elemental analysis to identify any nutrient homeostasis disruptions, similar to approaches used for other Arabidopsis mutants

What are the optimal experimental designs for studying CBSDUF5 function in Arabidopsis?

When studying CBSDUF5 function, researchers should consider augmented experimental designs that efficiently screen multiple genotypes and conditions. Based on experimental design principles for plant genetics:

  • Augmented Block Designs: Useful for comparing wild-type, CBSDUF5 knockouts, and overexpression lines alongside standard checks.

    • Include 3-5 check genotypes (e.g., wild-type, known mutants) replicated across all blocks

    • Add new genotypes (e.g., multiple independent CBSDUF5 knockout or overexpression lines) to each block

    • This design provides efficient use of resources while maintaining statistical power

  • Augmented Split-Plot Designs: Ideal for testing CBSDUF5 response to environmental factors.

    • Main plots: Different treatments (e.g., control, drought, salt stress)

    • Split plots: Different genotypes (wild-type, CBSDUF5 mutants)

    • This allows assessment of genotype-by-environment interactions

Example layout for an augmented block design with 3 checks and 13 new genotypes across 4 blocks:

Block 1Block 2Block 3Block 4
Check 1Check 1Check 1Check 1
Check 2Check 2Check 2Check 2
Check 3Check 3Check 3Check 3
New 1New 4New 8New 11
New 2New 5New 9New 12
New 3New 6New 10New 13
New 7

This design balances efficiency with statistical power for detecting differences in CBSDUF5 function .

How can I optimize protein extraction protocols specifically for CBSDUF5?

When extracting CBSDUF5 protein from plant tissue, consider these methodological approaches:

  • Buffer Optimization:

    • Use Tris/PBS-based buffer (pH 8.0) with 6% trehalose (similar to the storage buffer for recombinant protein)

    • Add protease inhibitors to prevent degradation

    • Include mild detergents (0.5-1% Triton X-100 or NP-40) to solubilize membrane-associated proteins

  • Tissue Selection and Preparation:

    • Optimize root tissue mass yield if studying CBSDUF5 in roots

    • Consider tissue-specific extraction based on expression patterns

    • Flash-freeze harvested tissue in liquid nitrogen and grind thoroughly to powder

  • Fractionation Methods:

    • If studying membrane localization, include membrane fractionation steps

    • Sequential extraction can help determine subcellular localization

    • Consider density gradient centrifugation to isolate specific membrane fractions

  • Yield Assessment:

    • Validate extraction efficiency using recombinant CBSDUF5 as a positive control

    • Optimize protein yield through iterative testing of different extraction conditions

    • Quantify protein using Bradford or BCA assays

What experimental approaches are appropriate for studying protein-protein interactions involving CBSDUF5?

To study protein-protein interactions involving CBSDUF5, consider these methodological approaches:

  • In vivo approaches:

    • Split-GFP complementation to visualize interactions in plant cells

    • Co-immunoprecipitation with CBSDUF5-specific antibodies or epitope tags

    • Bimolecular Fluorescence Complementation (BiFC) for direct visualization

    • Förster Resonance Energy Transfer (FRET) for detecting close-proximity interactions

  • In vitro approaches:

    • Pull-down assays using recombinant His-tagged CBSDUF5

    • Surface Plasmon Resonance (SPR) for measuring binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Large-scale screening:

    • Yeast two-hybrid screening, considering limitations mentioned in PhD thesis research

    • Proximity-dependent biotin identification (BioID)

    • Tandem Affinity Purification coupled with Mass Spectrometry (TAP-MS)

  • Computational predictions:

    • Use protein structure prediction tools to identify potential interaction domains

    • Molecular docking simulations to test specific protein pairs

    • Network analysis of co-expressed genes to identify potential interactors

How should data from CBSDUF5 expression studies be normalized and analyzed?

For normalizing and analyzing CBSDUF5 expression data:

  • RT-qPCR data normalization:

    • Select appropriate reference genes that remain stable under your experimental conditions

    • Consider technical limitations mentioned in research, including qRT-PCR issues

    • Use multiple reference genes and calculate geometric means for normalization

    • Apply the ΔΔCt method for relative quantification

  • RNA-Seq data analysis:

    • Normalize using methods such as FPKM, TPM, or DESeq2 normalization

    • Consider tissue-specific expression patterns

    • Address limitations of using whole seedling tissue versus specific cell types

    • Compare expression across developmental stages and in response to treatments

  • Statistical analysis:

    • For augmented experimental designs, use appropriate statistical models that account for the design structure

    • ANOVA partitioning of degrees of freedom should follow the structure shown in literature for augmented designs

    • Consider using mixed-effects models that account for both fixed and random effects

    • Apply multiple testing correction methods (e.g., Benjamini-Hochberg procedure)

  • Visualization approaches:

    • Create heat maps of CBSDUF5 expression across tissues/conditions

    • Plot expression changes over time in response to treatments

    • Visualize co-expression networks to identify functionally related genes

What approaches can be used to analyze potential regulatory elements in the CBSDUF5 promoter?

For analyzing regulatory elements in the CBSDUF5 promoter:

  • In silico analysis:

    • Identify the promoter region (typically 1-2 kb upstream of transcription start site)

    • Use databases like PLACE, PlantCARE, or PlantPAN to identify known cis-regulatory elements

    • Look for binding sites of transcription factors mentioned in related research, such as AtSCARECROW

    • Consider limitations of promoter analysis mentioned in research literature

  • Experimental validation:

    • Generate promoter deletion series fused to reporter genes (GUS, LUC, GFP)

    • Perform site-directed mutagenesis of predicted binding sites

    • Use Chromatin Immunoprecipitation (ChIP) to verify transcription factor binding

    • Consider Yeast one-hybrid (Y1H) analysis, noting considerations mentioned in PhD research

  • Integration with expression data:

    • Correlate presence of specific regulatory elements with expression patterns

    • Identify genes with similar expression profiles to CBSDUF5

    • Look for shared regulatory elements among co-expressed genes

  • Tools and databases:

    Tool/DatabaseApplicationURL
    PLACEPlant cis-acting regulatory elementshttps://www.dna.affrc.go.jp/PLACE/
    PlantCAREPlant cis-acting regulatory elementshttp://bioinformatics.psb.ugent.be/webtools/plantcare/html/
    PlantPANPlant promoter analysishttp://plantpan.itps.ncku.edu.tw/
    MEME SuiteDe novo motif discoveryhttps://meme-suite.org/
    JASPARTranscription factor binding profileshttp://jaspar.genereg.net/

How can I resolve contradictory findings when studying CBSDUF5 function across different experimental conditions?

When faced with contradictory findings regarding CBSDUF5 function:

  • Systematic analysis of variables:

    • Create a comprehensive table documenting all experimental variables (genotypes, growth conditions, tissue types, developmental stages)

    • Identify key differences between contradictory experiments

    • Design controlled experiments that specifically address these variables

  • Collaborative approach:

    • Consider multi-laboratory validation studies

    • Standardize protocols across research groups

    • Create a shared resource of plant lines and reagents

  • Meta-analysis methods:

    • Apply formal meta-analysis techniques to combine results across studies

    • Weight findings based on sample size and study design rigor

    • Identify consistent versus inconsistent trends

  • Alternative hypotheses development:

    • Consider context-dependent protein function

    • Explore potential post-translational modifications affecting function

    • Investigate genetic background effects

    • Consider redundancy with other family members

    • Examine potential environmental interactions

  • Advanced experimental designs:

    • Implement augmented experimental designs that can control for multiple sources of variation

    • Use row-column designs to control variability in two directions

    • Apply exploratory model selection methods to account for unexpected variation patterns

What are the best approaches for studying CBSDUF5 localization in plant cells?

For studying CBSDUF5 subcellular localization:

  • Fluorescent protein fusion approaches:

    • Generate N- and C-terminal GFP/RFP fusions, as tag position may affect localization

    • Express under native promoter to maintain physiological expression levels

    • Consider tissue-specific expression patterns

    • Use confocal microscopy for high-resolution imaging

  • Co-localization studies:

    • Use established organelle markers (ER, Golgi, plasma membrane, etc.)

    • Calculate co-localization coefficients (Pearson's, Manders')

    • Perform time-lapse imaging to detect dynamic localization changes

  • Biochemical fractionation:

    • Perform subcellular fractionation to isolate membrane components

    • Use Western blotting with anti-His antibodies (for recombinant protein) or specific CBSDUF5 antibodies

    • Compare fractionation profiles with known membrane protein markers

  • Immunohistochemistry:

    • Use specific antibodies against CBSDUF5 for in situ detection

    • Apply tissue clearing techniques for whole-mount imaging

    • Consider fixation methods optimized for membrane proteins

  • Electron microscopy approaches:

    • Immunogold labeling for ultrastructural localization

    • Correlative light and electron microscopy (CLEM) for combining fluorescence with ultrastructure

How can I investigate the role of CBSDUF5 in lateral root development?

To investigate CBSDUF5's potential role in lateral root development:

  • Genetic approaches:

    • Generate CBSDUF5 knockout and overexpression lines

    • Compare lateral root phenotypes with wild-type plants

    • Create double mutants with known lateral root regulators like AtMYB93

    • Analyze lateral root density phenotypes similar to approaches used for MYB mutants

  • Expression analysis:

    • Examine CBSDUF5 expression during lateral root initiation and development

    • Create promoter:GUS fusions to visualize spatial expression patterns

    • Perform cell-specific transcriptomics via FACS or single-cell RNA-seq

    • Compare with expression profiles of known lateral root regulators

  • Physiological assays:

    • Analyze lateral root responses to hormones (auxin, cytokinin, etc.)

    • Test responses to abiotic stresses (drought, salt, nutrient deficiency)

    • Quantify lateral root parameters (density, length, emergence timing)

    • Perform elemental analysis similar to approaches for MYB mutants

  • Cellular and molecular analysis:

    • Examine founder cell specification and early divisions

    • Analyze cell wall remodeling during lateral root emergence

    • Investigate potential interactions with endodermal membrane proteins

    • Study possible connections to Casparian strip membrane proteins

  • Experimental design considerations:

    • Implement augmented experimental designs for efficient phenotyping

    • Control environmental variables affecting root development

    • Use standardized growth conditions and media compositions

    • Consider technical challenges of root tissue isolation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.