Recombinant Arabidopsis thaliana DUF246 domain-containing protein At1g04910 (At1g04910)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana DUF246 Domain-Containing Protein At1g04910

The recombinant Arabidopsis thaliana DUF246 domain-containing protein At1g04910 (UniProt ID: Q8W486) is a full-length, His-tagged protein expressed in E. coli for research purposes. It belongs to the DUF246 family, a subgroup of glycosyltransferase-like proteins (GT65) conserved across land plants . This protein is annotated with the gene symbol OFUT1 (O-fucosyltransferase 1) and is involved in post-translational modifications, though its precise biochemical role remains under investigation .

Expression and Purification

  • Source: Recombinant protein expressed in E. coli with an N-terminal His-tag for affinity chromatography .

  • Form: Lyophilized powder with >90% purity confirmed via SDS-PAGE .

  • Storage: Stable at -20°C/-80°C; repeated freeze-thaw cycles are discouraged .

ParameterDetails
UniProt IDQ8W486
Gene NameAt1g04910 (aliases: OFUT1, F13M7.10)
Amino Acid SequenceFull-length (1–519 aa): Includes DUF246 domain and hydrophobic regions
TagN-terminal 10xHis-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)

Research Applications

  • ELISA Kits: Used as an antigen in immunoassays for detecting antibodies or protein interactions .

  • Structural Studies: Serves as a template for studying DUF246 domain interactions in Arabidopsis-based expression systems .

  • Biochemical Assays: Investigated for enzymatic activity in glycosyltransferase reactions, though substrates remain unidentified .

Expression Platforms

  • Arabidopsis Super-Expression System: While not directly used for At1g04910, this platform enables high-yield production of homologous proteins with native post-translational modifications .

  • E. coli Limitations: Prokaryotic expression may lack eukaryotic glycosylation patterns, necessitating alternative hosts for functional studies .

Functional Parallels

  • PAGR (At3g26370): A DUF246 homolog critical for male fertility in Arabidopsis, highlighting the family’s role in plant reproduction .

  • Immune Regulation: DUF246 proteins may indirectly influence pathogen resistance, as seen in ATG6-NPR1 interactions .

Challenges and Future Directions

  • Functional Gaps: Direct enzymatic activity of At1g04910 remains uncharacterized, requiring substrate screening and enzymatic assays .

  • Localization Studies: Conflicting predictions about transmembrane localization necessitate experimental validation (e.g., GFP fusion assays) .

  • Genetic Studies: Mutant phenotyping could clarify its role in development or stress responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
OFUT1; At1g04910; F13M7.10; O-fucosyltransferase 1; O-FucT-1; O-fucosyltransferase family protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-519
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
OFUT1
Target Protein Sequence
MRRLGHHRLHGKTGGVGTKGMVAKLSIGVIVLLICTLSLLFSANIGSNREPTRPSKINVE ELWESAKSGGWRPSSAPRSDWPPPTKETNGYLRVRCNGGLNQQRSAICNAVLAARIMNAT LVLPELDANSFWHDDSGFQGIYDVEHFIETLKYDVKIVGKIPDVHKNGKTKKIKAFQIRP PRDAPIEWYLTTALKAMREHSAIYLTPFSHRLAEEIDNPEYQRLRCRVNYHALRFKPHIM KLSESIVDKLRSQGHFMSIHLRFEMDMLAFAGCFDIFNPEEQKILRKYRKENFADKRLIY NERRAIGKCPLTPEEVGLILRAMRFDNSTRIYLAAGELFGGEQFMKPFRTLFPRLDNHSS VDPSEELSATSQGLIGSAVDYMVCLLSDIFMPTYDGPSNFANNLLGHRLYYGFRTTIRPD RKALAPIFIAREKGKRAGFEEAVRRVMLKTNFGGPHKRVSPESFYTNSWPECFCQMNPKK SSDKCPPNNVIEILDSRLESIRDPDSTSQTNSTVTGLER
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G04910

STRING: 3702.AT1G04910.1

UniGene: At.19171

Protein Families
Glycosyltransferase GT65R family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the DUF246 domain-containing protein At1g04910 and where is it found?

The DUF246 domain-containing protein At1g04910 is a member of the expanded DUF246 family within Arabidopsis thaliana (mouse-ear cress). This protein contains a Domain of Unknown Function 246 (DUF246) and belongs to a group of proteins related to glycosyltransferase (GT) family 65. The gene encoding this protein is located at locus At1g04910 on chromosome 1 of Arabidopsis thaliana, with the ORF name F13M7.10 . The protein is highly conserved throughout land plants, suggesting an evolutionarily important function .

How does the conservation of At1g04910 compare to other DUF246 proteins across plant species?

At1g04910 (also known as PAGR - Pectic ArabinoGalactan synthesis-Related) shows remarkably high conservation throughout land plants compared to other DUF246-containing proteins. Sequence comparison studies have revealed that the Selaginella moellendorffii and Physcomitrella patens orthologs of PAGR are 76.0% and 70.9% identical to the Arabidopsis protein, respectively. Other Arabidopsis DUF246 proteins have lower identity percentages with their basal land plant orthologs, ranging between 45% and 67.7%. This high degree of conservation is visible as shorter branch lengths within the PAGR clade in phylogenetic analyses of DUF246-containing proteins .

What is the proposed function of DUF246 domain-containing proteins in plants?

DUF246 domain-containing proteins in plants are part of an expanded family related to glycosyltransferase (GT) family 65. Current research suggests they are involved in plant-specific processes, particularly cell wall polysaccharide biosynthesis. The PAGR protein (At3g26370), a DUF246 family member related to At1g04910, affects the biosynthesis of rhamnogalacturonan-I (RG-I) arabinogalactans and is critical for pollen tube growth . Other studied DUF246 family members (MSR1 and MSR2) affect the production and secretion of mannans in Arabidopsis, though their precise role in mannan biosynthesis remains unclear . Given this context, At1g04910 is likely involved in cell wall polysaccharide modifications, potentially functioning as a glycosyltransferase.

How does At1g04910 relate to pectin biosynthesis and plant cell wall development?

Based on studies of related DUF246 proteins, At1g04910 likely plays a role in plant cell wall development, particularly in pectin biosynthesis. Pectins are structurally complex plant cell wall polysaccharides whose biosynthesis remains poorly understood. The related PAGR protein has been identified as affecting the biosynthesis of rhamnogalacturonan-I (RG-I) arabinogalactans, which are components of pectin . By analogy, At1g04910 may participate in pectin modification pathways, potentially contributing to cell wall integrity, flexibility, or specialized functions. The high conservation of these proteins across plant species underscores their importance in fundamental plant physiological processes .

What evidence suggests that At1g04910 may function as a glycosyltransferase?

While direct experimental evidence for At1g04910's glycosyltransferase activity is limited in the provided search results, several lines of evidence support this functional classification:

  • Domain homology: At1g04910 contains a DUF246 domain that places it in relation to glycosyltransferase family 65 proteins .

  • Functional studies of related proteins: The DUF246-containing protein PAGR affects arabinogalactan biosynthesis in pectin, consistent with glycosyltransferase function .

  • Bioinformatic analyses: Research aimed at identifying putative glycosyltransferases involved in rhamnogalacturonan-II biosynthesis has identified DUF246-containing proteins as candidates .

  • Structural features: The protein sequence contains features consistent with type II membrane proteins characteristic of many Golgi-localized glycosyltransferases involved in cell wall polysaccharide biosynthesis.

What are the recommended storage conditions for recombinant At1g04910 protein and why are they important?

The recombinant At1g04910 protein should be stored in a Tris-based buffer with 50% glycerol, which is optimized for protein stability. For short-term storage, aliquots can be kept at 4°C for up to one week. For longer storage periods, the protein should be kept at -20°C, while extended storage should be at -20°C or -80°C .

Repeated freezing and thawing is not recommended as this can lead to protein denaturation and loss of activity. This storage guideline is critical for maintaining protein integrity and biological activity for experimental applications. The high percentage of glycerol (50%) serves as a cryoprotectant, preventing ice crystal formation that can damage protein structure during freezing .

How should researchers design experiments to study At1g04910 function in plant cell wall synthesis?

When designing experiments to study At1g04910 function in plant cell wall synthesis, researchers should follow a systematic experimental design approach:

  • Define variables: The independent variable might be At1g04910 expression levels (wild-type, knock-out, overexpression), while dependent variables could include arabinogalactan content, pectin structure, cell wall integrity, or plant phenotypic traits like pollen tube growth .

  • Formulate testable hypotheses: For example, "Knockout of At1g04910 will decrease specific glycosidic linkages in cell wall pectins" or "Overexpression of At1g04910 will alter the composition of arabinogalactans."

  • Design experimental treatments: This might include:

    • Generation of knockout/knockdown lines using CRISPR/Cas9 or RNAi

    • Creation of overexpression lines

    • Complementation studies with wild-type and mutated versions of At1g04910

    • Domain swap experiments with other DUF246 proteins

  • Control extraneous variables: Consider developmental stage, tissue specificity, environmental conditions, and genetic background .

  • Measurement methods:

    • Biochemical analysis of cell wall composition

    • Immunolabeling of specific cell wall epitopes

    • Microscopic analysis of cell wall structure

    • Phenotypic assays for plant development and stress responses

    • Co-expression analysis with known cell wall synthesis genes

What methods can be used to analyze the glycosyltransferase activity of At1g04910?

To analyze the putative glycosyltransferase activity of At1g04910, researchers can employ several complementary approaches:

  • In vitro enzyme assays: Using the purified recombinant protein to test for glycosyltransferase activity with various donor substrates (UDP-sugars) and acceptor substrates (cell wall oligosaccharides) .

  • Radiolabeled substrate incorporation: Measuring the transfer of 14C- or 3H-labeled sugar moieties from nucleotide sugar donors to acceptor molecules.

  • Mass spectrometry analysis: Characterizing the products formed by At1g04910 to identify the specific glycosidic linkages being created.

  • Comparative cell wall analysis: Comparing the cell wall composition of wild-type plants versus At1g04910 mutants using techniques such as:

    • Comprehensive Microarray Polymer Profiling (CoMPP)

    • High-Performance Anion-Exchange Chromatography (HPAEC)

    • Glycosyl linkage analysis by methylation followed by GC-MS

  • Subcellular localization studies: Determining if At1g04910 localizes to the Golgi apparatus, where most glycosyltransferases involved in cell wall polysaccharide synthesis function.

  • Protein-protein interaction studies: Identifying potential interacting partners that might form functional complexes for coordinated polysaccharide synthesis.

How do sequence variations in At1g04910 orthologs across plant species correlate with cell wall composition differences?

This question addresses an advanced area of comparative genomics and structure-function relationships. Researchers investigating this topic should consider:

  • Comparative sequence analysis: Aligning At1g04910 sequences from diverse plant species and identifying conserved and variable regions. Particular attention should be paid to putative catalytic domains and substrate binding regions.

  • Correlation with cell wall composition: Different plant species exhibit variations in cell wall composition, particularly in pectin structure. By correlating specific amino acid substitutions in At1g04910 orthologs with known differences in cell wall composition across species, researchers can identify key residues that might determine substrate specificity or catalytic activity.

  • Evolutionary analysis: The high conservation of At1g04910 (76.0% identity with Selaginella moellendorffii and 70.9% with Physcomitrella patens orthologs) suggests strong evolutionary pressure to maintain function . Analyzing less conserved regions might reveal adaptation to species-specific cell wall requirements.

  • Domain swapping experiments: Creating chimeric proteins with domains from At1g04910 orthologs of different species to test functional conservation and specialization.

  • Complementation studies: Testing whether At1g04910 orthologs from different species can functionally complement Arabidopsis mutants to understand functional conservation.

What is the relationship between At1g04910 and other DUF246 family members in the context of cell wall synthesis regulatory networks?

Understanding the relationship between At1g04910 and other DUF246 family members requires investigation of their coordinated functions within broader regulatory networks:

  • Co-expression network analysis: Identifying genes whose expression patterns correlate with At1g04910 and other DUF246 family members across different tissues, developmental stages, and stress conditions.

  • Protein-protein interaction studies: Determining whether At1g04910 physically interacts with other DUF246 proteins or forms complexes with other cell wall synthesis enzymes.

  • Double/triple mutant analysis: Creating and characterizing plants with mutations in multiple DUF246 genes to identify functional redundancy or synergistic effects.

  • Transcription factor binding analysis: Identifying common transcription factors that regulate expression of At1g04910 and other DUF246 family members.

  • Comparative phosphoproteomics: Analyzing whether post-translational modifications, particularly phosphorylation, coordinate the activity of different DUF246 proteins in response to developmental or environmental cues.

  • Subcellular localization patterns: Determining whether different DUF246 proteins localize to distinct Golgi sub-compartments, suggesting specialized roles in polysaccharide synthesis.

How can structural predictions of At1g04910 inform site-directed mutagenesis studies to elucidate catalytic mechanisms?

Advanced structural biology approaches can guide functional studies of At1g04910:

  • Homology modeling: Using solved structures of related glycosyltransferases as templates to predict the 3D structure of At1g04910. The resulting model can identify putative active site residues and substrate binding pockets.

  • Molecular docking simulations: Predicting interactions between the modeled At1g04910 structure and potential substrates to inform hypothesis-driven mutagenesis.

  • Conserved motif analysis: Identifying highly conserved amino acid patterns across DUF246 proteins that might constitute catalytic sites or substrate recognition domains.

  • Rational design of mutations: Based on structural predictions, designing mutations to test specific hypotheses about:

    • Catalytic residues (acid/base catalysts)

    • Substrate binding determinants

    • Protein-protein interaction interfaces

    • Membrane association domains

  • Enzyme kinetics: Measuring how specific mutations affect substrate affinity (Km) and catalytic efficiency (kcat) to validate structural predictions.

  • Activity-structure relationship: Creating a series of truncated versions of At1g04910 to identify minimal functional domains and critical regions for activity.

What are the current technical limitations in studying DUF246 domain-containing proteins in plants?

Several technical challenges hamper the comprehensive characterization of DUF246 proteins like At1g04910:

  • Functional redundancy: The large DUF246 family in Arabidopsis (39 members) creates challenges in phenotypic analysis due to potential functional overlap .

  • Complex acceptor substrates: Studying glycosyltransferase activity in vitro often requires complex, heterogeneous plant cell wall oligosaccharides as acceptors, which are difficult to obtain in pure form.

  • Membrane-associated enzymes: As suggested by their sequence features, DUF246 proteins are likely membrane-associated, making expression and purification of active forms challenging .

  • Multiple potential donor/acceptor combinations: Testing all possible nucleotide sugar donors and acceptor substrates requires extensive screening.

  • Transient interactions: The interactions between glycosyltransferases and their substrates or other protein partners may be transient and difficult to capture experimentally.

  • Complex regulation: Post-translational modifications and protein complex formation may regulate activity in ways that are difficult to replicate in vitro.

How might CRISPR/Cas9 gene editing approaches be optimized for studying At1g04910 function?

CRISPR/Cas9 technology offers powerful approaches for studying At1g04910 function, but requires careful optimization:

  • Guide RNA design: Designing highly specific gRNAs targeting conserved regions of At1g04910 while avoiding off-target effects on related DUF246 genes.

  • Multiplex editing: Simultaneously targeting At1g04910 along with functionally redundant DUF246 family members to overcome compensation effects.

  • Tissue-specific knockouts: Using tissue-specific promoters to drive Cas9 expression, allowing study of At1g04910 function in specific developmental contexts while avoiding potential lethality of complete knockouts.

  • Conditional knockouts: Implementing inducible CRISPR systems to control the timing of At1g04910 disruption.

  • Base editing and prime editing: Making precise single nucleotide changes to test the importance of specific residues without complete gene disruption.

  • Knock-in strategies: Inserting reporter tags or specific mutations to study protein localization, dynamics, and structure-function relationships.

  • Validation approaches: Developing robust methods to confirm editing efficiency and specificity, including targeted sequencing and analysis of potential off-target effects.

What interdisciplinary approaches could advance our understanding of At1g04910's role in plant cell wall biosynthesis?

Advancing knowledge about At1g04910 function will likely require integration of multiple disciplines:

  • Glycobiology and structural biology: Determining enzyme specificity and mechanism through in vitro studies and structural analysis.

  • Systems biology: Integrating transcriptomics, proteomics, and metabolomics data to place At1g04910 in broader metabolic and developmental networks.

  • Advanced imaging: Applying super-resolution microscopy and electron tomography to visualize cell wall architecture in wild-type versus mutant plants.

  • Computational biology: Using machine learning to identify patterns in sequence-structure-function relationships across the DUF246 family.

  • Plant physiology: Connecting molecular changes in cell wall composition to whole-plant phenotypes and environmental responses.

  • Evolutionary biology: Examining the diversification of DUF246 proteins across plant lineages to understand their roles in plant adaptation.

  • Synthetic biology: Engineering novel activities or expression patterns of At1g04910 to create plants with modified cell wall properties for basic research or applications.

What are the relative advantages and limitations of different expression systems for recombinant At1g04910 protein production?

Different expression systems offer various trade-offs for producing recombinant At1g04910:

Expression SystemAdvantagesLimitationsBest Applications
E. coli- High yield
- Low cost
- Simple protocols
- Rapid production
- Lack of plant-specific post-translational modifications
- Potential improper folding
- Inclusion body formation
- Lack of glycosylation
- Protein structure studies
- Antibody production
- Limited functional studies
Yeast (S. cerevisiae, P. pastoris)- Eukaryotic folding machinery
- Some post-translational modifications
- Higher yields than mammalian cells
- Secretion possible
- Glycosylation patterns differ from plants
- Limited capacity for complex modifications
- Protein interaction studies
- Basic enzymatic assays
- Moderate-scale production
Insect cells- Complex eukaryotic folding
- Many post-translational modifications
- Higher expression of membrane proteins
- Higher cost than bacterial/yeast systems
- Complex glycosylation differs from plants
- Structural biology
- Functional assays requiring folding
- Membrane protein production
Plant cell cultures- Native-like post-translational modifications
- Appropriate subcellular targeting
- Native folding environment
- Lower yields
- Longer production time
- More expensive
- Enzymatic activity assays
- Protein-protein interactions
- Subcellular localization studies
Transient expression in N. benthamiana- Native plant environment
- Rapid results (days)
- Co-expression with partners
- In planta activity
- Variable expression levels
- Limited scale
- Requires specialized facilities
- In vivo functional validation
- Localization studies
- Plant-specific interactions
Transgenic Arabidopsis- Native expression context
- Physiological regulation
- Long-term studies possible
- Low yields for purification
- Time-consuming (months)
- Genetic background effects
- Complementation studies
- In vivo function
- Developmental analyses

Selection of the optimal expression system should be guided by the specific research questions and downstream applications.

How can researchers effectively design controls for experiments investigating At1g04910 function?

Proper experimental controls are essential for rigorous investigation of At1g04910 function:

  • Genetic controls:

    • Wild-type plants (positive control)

    • Known cell wall mutants affecting different pathways (comparative controls)

    • Other DUF246 mutants (specificity controls)

    • Complemented lines expressing At1g04910 in the mutant background (rescue controls)

  • Biochemical assay controls:

    • Heat-inactivated enzyme (negative control)

    • Known active glycosyltransferases (positive control)

    • Reactions without donor or acceptor substrates (substrate controls)

    • Reactions with structurally modified substrates (specificity controls)

  • Expression controls:

    • Empty vector transformants (negative control)

    • Known subcellular markers co-expressed (localization controls)

    • Expression of catalytically inactive mutants (activity controls)

    • Inducible expression systems (temporal controls)

  • Technical controls:

    • Multiple independent transgenic/mutant lines (biological replicates)

    • Multiple technical replicates for each measurement

    • Randomization of sample processing order

    • Blinding in phenotypic analyses where possible

  • Validation controls:

    • Multiple methods to confirm the same result

    • Independent confirmation using different genetic backgrounds

    • Dose-response relationships where applicable

    • Rescue experiments with orthologs from other species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.