Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase At4g11680 (At4g11680)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant At4g11680 belongs to the RING-type E3 ubiquitin ligase family, which facilitates substrate-specific ubiquitination by transferring ubiquitin from E2 conjugating enzymes to target proteins. Key features include:

AttributeDetails
Gene NameAt4g11680
SynonymsRING finger protein At4g11680; T5C23.110
SpeciesArabidopsis thaliana (Mouse-ear cress)
Protein LengthFull-length (1-390 amino acids)
Molecular Weight~44 kDa (calculated)
TagN-terminal His-tag
Expression SystemEscherichia coli
Purity>90% (SDS-PAGE verified)

Amino Acid Sequence

The protein sequence begins with:
MSSSSSTTTNTTTESDSSSLPTHIGRSNSDGIIDTTPFLPPTVTRTISVDEESNPIHRSA...
Key domains include:

  • RING Finger Domain: Critical for E2 binding and ubiquitin transfer activity.

  • Transmembrane Regions: Predicted hydrophobic segments (e.g., residues 150-170) suggest membrane association .

Quality Control

  • Purity: Validated via SDS-PAGE (>90%) .

  • Activity: Confirmed by in vitro self-ubiquitination assays (common for E3 ligases) .

Functional Significance in Plant Biology

E3 ligases like At4g11680 regulate diverse cellular processes:

  • Abiotic Stress Responses: Related RING-type ligases (e.g., AtCHIP) mediate thermotolerance and drought resistance by degrading misfolded proteins .

  • Circadian Rhythms: Homologs such as AtSINAL7 exhibit circadian expression patterns, linking ubiquitination to developmental timing .

  • Hormone Signaling: E3 ligases modulate abscisic acid (ABA) pathways, affecting seed dormancy and stress adaptation .

Experimental Uses

  • Ubiquitination Assays: Study substrate specificity and enzyme kinetics .

  • Protein-Protein Interaction Screens: Identify binding partners via His-tag pulldowns .

  • Stress Response Studies: Investigate roles in heat, salinity, or pathogen resistance .

Key Findings from Related Studies

StudyInsight
AtSINAL7 (Homolog)Self-ubiquitination activity dependent on Lys-124; circadian regulation .
BRIZ E3 Ligase ComplexSuppresses ABA hypersensitivity during seed germination .
LUBAC ComplexSynthesizes linear ubiquitin chains to regulate stress signaling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its inclusion.
Synonyms
At4g11680; T5C23.110; E3 ubiquitin-protein ligase At4g11680; RING finger protein At4g11680; RING-type E3 ubiquitin transferase At4g11680
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g11680
Target Protein Sequence
MSSSSSTTTNTTTESDSSSLPTHIGRSNSDGIIDTTPFLPPTVTRTISVDEESNPIHRSA RRQGLREAARFLRHAGSRRMMREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWNLAF VAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEYRRRRRRRHPEDGGGSGLT NSSSQQYVSLAQLEDRGETSNPAKHLESANTMFSFIWWIIGFYWVSAGGQTLSSDSPQLY WLCIIFLGFDVFFVVFCVALACVIGLAVCCCLPCIIAILYAVADQEGASKNDIDQMPKFR FTKTGNVEKLSGKARGIMTECGTDSPIERSLSPEDAECCICLCEYEDGVELRELPCNHHF HCTCIDKWLHINSRCPLCKFNILKNANNEV
Uniprot No.

Target Background

Function

Mediates E2-dependent protein ubiquitination in vitro.

Database Links

KEGG: ath:AT4G11680

STRING: 3702.AT4G11680.1

UniGene: At.20734

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.