Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL15 (ATL15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ATL15; At1g22500; F12K8.15; E3 ubiquitin-protein ligase ATL15; RING-H2 finger protein ATL15; RING-type E3 ubiquitin transferase ATL15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-381
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL15
Target Protein Sequence
SSEFDDEGRTSFSPTTAIIMIVLVSVFFALGCISVYMRRCLQHALGMDSGGGPGNWLNVR QTTEPGLDASVIETFPTFPYSTVKTLRIGKEALECPVCLNEFEDDETLRLIPQCCHVFHP GCIDAWLRSQTTCPLCRANLVPVPGESVSSEIPGLARETGQNSLRTPIDDNRKRVLTSPD ERLIDSVAWTGNQSMPRKSMSTGWKLAELYSPASSPGQPEENLDRYTLRLPQEIHDQLVN SSLGKQGSKGQLALPQERSSVRGFRTGSLGTEKNYFYFERFDQDGRLDRRPFSITPPYHT RSIQSPDEIINASGNYQDRAGAPKGLLLAIRSPFDRLFTGKKNAGERSYLQSGDASPV
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL15 (ATL15) is an E3 ubiquitin-protein ligase that catalyzes polyubiquitination in vitro with ubiquitin-conjugating enzymes E2 UBC8, UBC10, UBC11, UBC28, and UBC29.
Gene References Into Functions
  1. ATL15 plays a significant role as a membrane-localized ubiquitin ligase regulating sugar-responsive plant growth in Arabidopsis. PMID: 28690153
Database Links

KEGG: ath:AT1G22500

STRING: 3702.AT1G22500.1

UniGene: At.19245

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL15 and what is its functional role in Arabidopsis thaliana?

ATL15 (Arabidopsis Tóxicos en Levadura 15) is a plant-specific RING-type E3 ubiquitin ligase encoded by the At1g22500 gene in Arabidopsis thaliana. It belongs to the ATL family, of which 91 isoforms have been identified in the Arabidopsis genome. Functionally, ATL15 plays a significant role in regulating sugar-responsive plant growth through its ubiquitin ligase activity .

The protein demonstrates clear involvement in sugar signaling pathways, as evidenced by its rapid down-regulation in the presence of sugar. Genetic studies have confirmed its biological significance, showing that atl15 knockout mutants are insensitive to high glucose concentrations, while plants overexpressing ATL15 exhibit depressed growth patterns. Furthermore, both endogenous glucose and starch levels are reciprocally affected in knockout mutants compared to overexpression lines .

As an E3 ubiquitin ligase, ATL15 catalyzes the transfer of ubiquitin molecules to specific target proteins, marking them for various cellular processes including degradation, trafficking, or functional modification. This post-translational modification mechanism allows for precise regulation of protein abundance and activity in response to changing sugar conditions within the plant.

What are the recommended storage and handling conditions for recombinant ATL15?

Proper storage and handling of recombinant ATL15 are crucial for maintaining protein integrity and enzymatic activity. Based on established protocols, the following guidelines should be followed :

  • Long-term storage: Store the lyophilized powder at -20°C to -80°C upon receipt. For the reconstituted protein, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being optimal) and store in aliquots at -20°C to -80°C.

  • Working storage: Store working aliquots at 4°C for up to one week.

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity. It is better to prepare multiple small aliquots for single use.

  • Buffer conditions: The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability.

  • Reconstitution: Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

Following these storage and handling recommendations will help ensure consistent experimental results when working with recombinant ATL15 protein.

What is the ATL family of proteins and how does ATL15 relate to other family members?

The Arabidopsis Tóxicos en Levadura (ATL) family is a group of plant-specific RING-type ubiquitin ligases characterized by their membrane localization via N-terminal transmembrane-like domains. Currently, 91 ATL isoforms have been identified in the Arabidopsis genome . These proteins share several defining features:

  • A conserved RING-H2 zinc finger domain that confers E3 ubiquitin ligase activity

  • N-terminal hydrophobic regions that target the proteins to membranes

  • Variable C-terminal domains that likely determine substrate specificity

ATL15 (also known as At1g22500) is officially designated as "E3 ubiquitin-protein ligase ATL15" and is synonymous with "RING-H2 finger protein ATL15" and "RING-type E3 ubiquitin transferase ATL15" . It shares the core structural features of the ATL family but has specialized in sugar response regulation.

While several ATL family members have been reported to be involved in regulating plant responses to environmental stresses, ATL15 specifically functions in sugar-responsive growth regulation . This specialization highlights the evolutionary diversification within the ATL family to control different aspects of plant physiology through the common mechanism of targeted protein ubiquitination.

The functional divergence among ATL family members provides an excellent model system for studying how structural variations in conserved protein families can lead to specialized physiological roles in plant development and environmental adaptation.

What evidence supports ATL15's function as a ubiquitin ligase in sugar signaling pathways?

Multiple lines of evidence support ATL15's role as a functional ubiquitin ligase involved in sugar signaling pathways:

  • Biochemical activity: In vitro assays have confirmed that ATL15 possesses ubiquitin ligase activity, demonstrating its ability to catalyze polyubiquitination when paired with specific E2 ubiquitin-conjugating enzymes. Recombinant ATL15 has been shown to work with several E2 enzymes including UBC8, UBC10, UBC11, UBC28, and UBC29 .

  • Gene expression response: Transcriptome analysis has identified ATL15 as a sugar-responsive gene in Arabidopsis. Its expression is rapidly down-regulated in the presence of sugar, indicating a direct relationship with sugar sensing mechanisms .

  • Genetic evidence: Knockout and overexpression studies provide compelling evidence for ATL15's biological function. The atl15 knockout mutants display insensitivity to high glucose concentrations, while ATL15 overexpression results in depressed plant growth. Additionally, endogenous glucose and starch amounts are reciprocally affected in these genetically modified lines .

  • Subcellular localization: ATL15 localizes to plasma membrane and endomembrane compartments, consistent with its predicted transmembrane domain and positioning it appropriately to interface with sugar transport and signaling components .

  • Structural features: The protein contains the characteristic C3HC4-type RING zinc finger domain that is essential for E3 ubiquitin ligase function, further supporting its predicted enzymatic activity .

These multiple layers of evidence collectively establish ATL15 as a membrane-localized ubiquitin ligase that plays a significant regulatory role in sugar-responsive growth pathways in Arabidopsis.

What experimental approaches are recommended for studying ATL15 ubiquitination targets?

Identifying and characterizing the targets of ATL15-mediated ubiquitination requires a multi-faceted experimental approach:

  • Yeast two-hybrid screening: Utilize the C-terminal domain of ATL15 (excluding the transmembrane region) as bait to screen Arabidopsis cDNA libraries for potential interacting proteins. This approach can identify direct binding partners that may be ubiquitination targets.

  • Co-immunoprecipitation coupled with mass spectrometry: Express tagged versions of ATL15 in Arabidopsis or protoplasts, then immunoprecipitate the protein complex and analyze by mass spectrometry to identify associated proteins. Compare samples treated with and without proteasome inhibitors to enrich for ubiquitinated targets.

  • In vitro ubiquitination assays: Use purified recombinant ATL15 protein along with E1, E2 enzymes (particularly UBC8, UBC10, UBC11, UBC28, and UBC29) , ubiquitin, and candidate substrate proteins to test direct ubiquitination activity.

  • Global proteomics approach: Compare the ubiquitinome (all ubiquitinated proteins) between wild-type plants and atl15 mutants under normal and high sugar conditions using ubiquitin remnant profiling techniques.

  • Differential protein stability analysis: Identify proteins whose stability changes in response to sugar in wild-type plants but not in atl15 mutants by using cycloheximide chase assays or pulsed SILAC (Stable Isotope Labeling with Amino acids in Cell culture) approaches.

  • Proximity-dependent biotin identification (BioID): Fuse ATL15 to a biotin ligase to biotinylate proteins in close proximity, then identify these proteins by mass spectrometry to discover potential substrates in their native cellular environment.

When designing these experiments, it's crucial to consider the membrane localization of ATL15 and to include appropriate controls for validating true substrate proteins versus nonspecific interactions.

How can researchers effectively study the membrane localization patterns of ATL15?

Studying the membrane localization of ATL15 requires specialized techniques that preserve membrane integrity while providing high-resolution visualization. The following methodological approaches are recommended:

  • Fluorescent protein fusion and confocal microscopy: Generate N- or C-terminal fusions of ATL15 with fluorescent proteins (GFP, YFP, or mCherry) and express these in Arabidopsis or protoplasts. Confocal microscopy can then be used to visualize the subcellular localization. Co-localization studies with known membrane markers (for plasma membrane, endoplasmic reticulum, Golgi, etc.) will help precisely define the compartments where ATL15 resides.

  • Membrane fractionation: Perform subcellular fractionation to separate different membrane compartments, followed by Western blotting to detect native or tagged ATL15. This biochemical approach complements imaging techniques and can confirm the association of ATL15 with specific membrane fractions.

  • Immunogold electron microscopy: For ultra-high resolution, use immunogold labeling with antibodies against ATL15 or its tag, followed by electron microscopy to visualize the precise membrane localization at the nanometer scale.

  • Protein topology analysis: Determine the orientation of ATL15 in the membrane using protease protection assays or fluorescence protease protection (FPP) assays, which can reveal which domains face the cytosol versus the lumen/extracellular space.

  • Domain deletion/mutation analysis: Create a series of constructs with deletions or mutations in the N-terminal hydrophobic domain to map the specific sequences required for proper membrane targeting and retention.

  • Dynamic studies: Employ techniques like fluorescence recovery after photobleaching (FRAP) or photoactivatable fluorescent proteins to study the dynamics of ATL15 movement between membrane compartments, especially in response to sugar treatments.

When conducting these studies, it's important to verify that any tagged versions of ATL15 retain functional activity to ensure that the localization patterns observed are physiologically relevant.

What controls should be included when studying ATL15 knockout or overexpression lines?

When designing experiments with ATL15 genetic manipulation, the following controls are essential for rigorous scientific interpretation:

  • Multiple independent transgenic/mutant lines: Use at least 2-3 independent knockout lines and overexpression lines to control for positional effects of T-DNA insertions or transgene integration sites.

  • Complementation lines: For knockout studies, include lines where the wild-type ATL15 gene has been reintroduced to confirm that observed phenotypes are due to the absence of ATL15 rather than background mutations.

  • Expression level verification: Quantify ATL15 transcript levels by qRT-PCR and protein levels by Western blotting in all lines to confirm the degree of knockout or overexpression.

  • Enzymatic activity controls: For overexpression lines, include catalytically inactive versions of ATL15 (with mutations in the RING domain) to distinguish between effects caused by ubiquitin ligase activity versus those resulting from protein-protein interactions.

  • Sugar response controls: Include both sugar-treated and non-treated conditions, with multiple sugar concentrations and different sugar types (glucose, sucrose, etc.) to fully characterize the specificity of ATL15's involvement in sugar responses.

  • Developmental stage controls: Assess phenotypes across multiple developmental stages since sugar sensitivity can vary throughout the plant life cycle.

  • Environmental condition standardization: Carefully control light, temperature, and humidity conditions, as these factors can influence sugar metabolism and signaling pathways.

  • Cellular markers: Include measurements of standard markers for sugar response pathways, such as ABA-responsive genes or genes involved in starch metabolism, to place ATL15 function in the context of known sugar signaling networks.

  • Related ATL family member expression: Check for potential compensatory changes in expression of other ATL family members in response to ATL15 manipulation.

By incorporating these controls, researchers can avoid common pitfalls in interpretation and establish the specific role of ATL15 in sugar-responsive growth regulation with greater confidence.

What are the recommended protocols for purification and in vitro activity assays of recombinant ATL15?

When working with recombinant ATL15 protein for purification and in vitro activity characterization, the following methodological protocols are recommended:

Purification Protocol:

  • Expression system: Express His-tagged ATL15 (amino acids 24-381) in E. coli . BL21(DE3) or similar strains are typically used for optimal protein expression.

  • Induction conditions: Induce protein expression at low temperature (16-18°C) with 0.1-0.5 mM IPTG when cultures reach OD600 of 0.6-0.8 to minimize inclusion body formation.

  • Cell lysis: Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, 1 mM DTT, protease inhibitors, and 0.1% non-ionic detergent to help solubilize the membrane-associated protein.

  • Affinity purification: Purify using Ni-NTA affinity chromatography with sequential washes of increasing imidazole concentration and final elution with 250-300 mM imidazole.

  • Secondary purification: Further purify by size exclusion chromatography to ensure homogeneity.

  • Buffer exchange: Exchange into storage buffer (Tris/PBS-based buffer with 6% trehalose, pH 8.0) and concentrate to desired concentration.

  • Quality control: Assess purity by SDS-PAGE (should be >90%) and verify identity by Western blot using anti-His antibodies or ATL15-specific antibodies.

In Vitro Ubiquitination Assay Protocol:

  • Reaction components:

    • Purified recombinant ATL15 (50-100 nM)

    • E1 ubiquitin-activating enzyme (50-100 nM)

    • E2 ubiquitin-conjugating enzymes (use UBC8, UBC10, UBC11, UBC28, or UBC29 at 250-500 nM)

    • Ubiquitin (5-10 μM)

    • ATP regeneration system (2 mM ATP, 10 mM creatine phosphate, 3.5 U/mL creatine kinase)

    • Buffer: 50 mM Tris-HCl (pH 7.5), 5 mM MgCl2, 2 mM DTT

  • Reaction conditions: Incubate at 30°C for 1-3 hours.

  • Analysis methods: Analyze reaction products by:

    • SDS-PAGE followed by Western blotting with anti-ubiquitin antibodies

    • Mass spectrometry to identify ubiquitination sites on substrate proteins

    • Quantitative assays using fluorescently labeled ubiquitin to measure reaction kinetics

  • Controls: Include negative controls (omitting ATP, E1, E2, or using catalytically inactive ATL15) and positive controls (known E3 ligase with its E2 partner).

These protocols provide a foundation for biochemical characterization of ATL15's ubiquitin ligase activity and can be modified based on specific experimental requirements.

Biochemical Properties of Recombinant ATL15 Protein

PropertySpecificationReference
Protein NameE3 ubiquitin-protein ligase ATL15
SynonymsATL15; At1g22500; F12K8.15; RING-H2 finger protein ATL15; RING-type E3 ubiquitin transferase ATL15
UniProt IDQ9SK92
Source OrganismArabidopsis thaliana
Expression SystemE. coli
Protein LengthFull Length of Mature Protein (24-381 amino acids)
TagN-terminal His tag
Molecular WeightApproximately 40 kDa
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C to -80°C
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Compatible E2 EnzymesUBC8, UBC10, UBC11, UBC28, UBC29

Functional Characteristics of ATL15 in Arabidopsis

ParameterObservationReference
Gene Expression Response to SugarRapidly down-regulated in the presence of sugar
Subcellular LocalizationPlasma membrane and endomembrane compartments
Knockout PhenotypeInsensitivity to high glucose concentrations
Overexpression PhenotypeDepressed plant growth
Effect on Glucose LevelsReciprocal changes in knockout vs. overexpression lines
Effect on Starch LevelsReciprocal changes in knockout vs. overexpression lines
Induction StimuliLight and ascorbate stimulus
Functional RoleRegulates sugar-responsive plant growth

What are the major technical challenges in studying ATL15 function?

Several technical challenges exist in fully characterizing ATL15 function:

  • Membrane protein solubilization: The membrane localization of ATL15 presents challenges for protein purification and structural studies. Determining optimal detergent conditions that maintain protein activity while efficiently extracting it from membranes remains difficult.

  • Substrate identification: Identifying the physiological ubiquitination targets of ATL15 is challenging due to the often transient nature of E3-substrate interactions and the rapid degradation of ubiquitinated proteins by the proteasome.

  • Functional redundancy: With 91 ATL family members in Arabidopsis , potential functional redundancy may mask phenotypes in single knockout studies, necessitating multiple gene knockouts or more sophisticated approaches.

  • Contextual activity: ATL15's activity is highly context-dependent, varying with sugar availability, developmental stage, and potentially other environmental factors, making standardized experimental conditions crucial but challenging to establish.

  • Spatiotemporal regulation: Understanding how ATL15 activity is regulated at different developmental stages and in different tissues requires sophisticated genetic tools and imaging techniques.

Addressing these challenges will require interdisciplinary approaches combining biochemistry, cell biology, genetics, and systems biology to fully elucidate ATL15's role in plant sugar signaling networks.

What emerging technologies could advance our understanding of ATL15 function?

Emerging technologies offer new opportunities to overcome current limitations in ATL15 research:

  • CRISPR-Cas9 genome editing: Precise editing of the ATL15 gene and its regulatory elements could create allelic series with varying activity levels or tissue-specific expression patterns.

  • Proximity labeling proteomics: Techniques like TurboID or APEX2 fused to ATL15 could identify proximal proteins in living cells, potentially revealing both substrates and regulatory partners.

  • Single-cell transcriptomics: Analyzing ATL15 expression at the single-cell level could reveal cell type-specific functions and regulatory patterns that are obscured in whole-tissue studies.

  • Cryo-electron microscopy: Advanced structural biology techniques could potentially resolve the three-dimensional structure of ATL15, especially in complex with E2 enzymes or substrates.

  • Optogenetics: Light-inducible control of ATL15 activity could enable precise spatiotemporal manipulation of its function to dissect its role in sugar signaling dynamics.

  • Synthetic biology approaches: Engineered versions of ATL15 with modified domains or novel functions could help dissect the structure-function relationships and potentially create plants with altered sugar response characteristics.

  • Metabolomics integration: Comprehensive metabolite profiling integrated with transcriptomics and proteomics could provide a systems-level understanding of how ATL15 influences metabolic networks beyond glucose and starch.

These technological advances promise to provide deeper insights into the molecular mechanisms by which ATL15 regulates sugar-responsive plant growth and development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.